2Q5X: C-terminal domain of hNup98

Crystal Structure of the C-terminal domain of hNup98. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Oct 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,300
Mol. weight: 17.54 kDa
Released: 14 Oct 2008

Explore 2Q5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q5X contains 5 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	718	1	1
β-strand	724-727	4	2
α-helix	730-736	7
β-strand	744-752	9	2
β-strand	756-765	10	2
β-strand	770	1	1
α-helix	771-774	4
β-strand	775-778	4	3
β-strand	781-784	4	3
α-helix	792-793	2
β-strand	796	1	4
β-strand	799	1	4
β-strand	802-806	5	2
β-strand	812	1	5
β-strand	819	1	5
α-helix	823-828	6
α-helix	831-841	11
β-strand	845-850	6	2
β-strand	855-860	6	2
β-strand	866-867	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup98	A	protein	155	Homo sapiens	P52948 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q5X_1 Nuclear pore complex protein Nup98 (chains A)
GIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIV
HIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRL
EAVSRKQGAQFKEYRPETGSWVFKVSHFAKYGLQD

Primary citation

Structural constraints on autoprocessing of the human nucleoporin Nup98. Sun, Y., Guo, H.C. Protein Sci (2008) 17:494-505. DOI 10.1110/ps.073311808 · PubMed

Other PDB entries of the same protein (UniProt P52948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZM 0.9 Å, GFGNFGTS from low-complexity/FG repeat domain of Nup98, residues 116-123
9PLM 1.32 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-021)
32QT 1.47 Å, Human NUP98 APD (SG P21)
32QU 1.5 Å, Human NUP98 APD (SG P41212)
9PLL 1.6 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-056)
3MMY 1.65 Å, Structural and functional analysis of the interaction between the nucleoporin Nup98 and…
7MNI 2.0 Å, Crystal structure of the N-terminal domain of NUP88 in complex with NUP98 C-terminal…
2Q5Y 2.3 Å, Crystal Structure of the C-terminal domain of hNup98
7F90 2.39 Å, Crystal structure of SARS auxiliary protein in complex with human nuclear protein
7VPG 2.49 Å, Crystal structure of the C-terminal tail of SARS-CoV-1 Orf6 complex with human…
8CI8 2.67 Å, Cryo-EM structure of the Nup98(298-327) fibril
7Q64 2.76 Å, Cryo-em structure of the Nup98 fibril polymorph 1

Browse structure collections

About this viewer

MolViewer shows 2Q5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.