3MMY: MRNA export factor

Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Determined by X-ray diffraction at 1.65 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 8
Atoms: 13,731
Mol. weight: 189.94 kDa
Released: 2 Jun 2010

Explore 3MMY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MMY contains 52 α-helices and 140 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and E: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
β-strand	15-16	2	2
α-helix	31	1
β-strand	32-33	2	3
α-helix	34	1
β-strand	42-47	6	4
α-helix	48-49	2
β-strand	55-61	7	4
β-strand	65-71	7	4
β-strand	77-84	8	4
β-strand	89-94	6	5
β-strand	100-105	6	5
β-strand	109-114	6	5
β-strand	119-125	7	5
β-strand	130-137	8	6
β-strand	142-148	7	6
β-strand	152-156	5	6
β-strand	165-168	4	6
β-strand	173-179	7	7
β-strand	182-187	6	7
α-helix	188-190	3
β-strand	192-196	5	7
β-strand	202-206	5	7
β-strand	215-222	8	8
β-strand	228-235	8	8
β-strand	239-244	6	8
α-helix	250-253	4
β-strand	255-258	4	8
β-strand	261-262	2	9
α-helix	269-270	2
β-strand	271-273	3	9
β-strand	276-281	6	10
β-strand	288-292	5	10
β-strand	297-301	5	10
β-strand	306-310	5	10
α-helix	311-314	4
β-strand	318-323	6	3
β-strand	330-334	5	3
α-helix	342-344	3
α-helix	350-351	2
β-strand	352-356	5	3
β-strand	364	1	11

Chains B, D, F and H: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	163-164	2
α-helix	166-167	2
β-strand	168-172	5	9
β-strand	181-186	6	9
α-helix	189-191	3
α-helix	200-209	10

Chains C and G: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	11
β-strand	15-16	2	10
α-helix	31	1
β-strand	32-33	2	12
α-helix	34	1
β-strand	42-47	6	13
α-helix	48-49	2
β-strand	55-61	7	13
β-strand	65-71	7	13
β-strand	77-84	8	13
β-strand	89-94	6	14
β-strand	100-105	6	14
β-strand	109-114	6	14
β-strand	119-125	7	14
β-strand	130-137	8	15
β-strand	142-148	7	15
β-strand	152-156	5	15
β-strand	165-168	4	15
β-strand	173-179	7	16
β-strand	182-187	6	16
α-helix	188-190	3
β-strand	191-196	6	16
β-strand	202-206	5	16
β-strand	215-222	8	17
β-strand	228-235	8	17
β-strand	239-244	6	17
α-helix	250-253	4
β-strand	255-258	4	17
β-strand	261	1	18
α-helix	270	1
β-strand	271-273	3	18
β-strand	276-281	6	2
β-strand	288-292	5	2
β-strand	297-301	5	2
β-strand	306-310	5	2
α-helix	311-314	4
β-strand	318-323	6	12
β-strand	330-334	5	12
α-helix	342-344	3
α-helix	350-351	2
β-strand	352-356	5	12
β-strand	364	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRNA export factor	A, C, E, G	protein	368	Homo sapiens	P78406 (AlphaFold model)
Nuclear pore complex protein Nup98	B, D, F, H	protein	56	Homo sapiens	P52948 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>3MMY_1 mRNA export factor (chains A, C, E, G)
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK

Sequence of entity 2 (B, D, F, H), FASTA

>3MMY_2 Nuclear pore complex protein Nup98 (chains B, D, F, H)
TGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRK

Primary citation

Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren, Y., Seo, H.S., Blobel, G. et al. Proc Natl Acad Sci U S A (2010) 107:10406-10411. DOI 10.1073/pnas.1005389107 · PubMed

Other PDB entries of the same protein (UniProt P78406 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7F90 2.39 Å, Crystal structure of SARS auxiliary protein in complex with human nuclear protein
7VPG 2.49 Å, Crystal structure of the C-terminal tail of SARS-CoV-1 Orf6 complex with human…
7VPH 2.8 Å, Crystal structure of the C-terminal tail of SARS-CoV-2 Orf6 complex with human…
7F60 2.85 Å, Crystal structure of auxiliary protein in complex with human nuclear protein
4OWR 3.15 Å, Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair…

Browse structure collections

About this viewer

MolViewer shows 3MMY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.