2Q8Y: 27.5 kDa virulence protein

Structural insight into the enzymatic mechanism of the phophothreonine lyase. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Salmonella enteritidis, Homo Sapiens
Chains: 2
Atoms: 2,025
Mol. weight: 28.93 kDa
Released: 11 Dec 2007

Explore 2Q8Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q8Y contains 14 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	29-35	7
α-helix	37-45	9
α-helix	48-50	3
α-helix	61-65	5
β-strand	71-73	3	1
β-strand	76-79	4	1
β-strand	86-91	6	1
α-helix	92-94	3
β-strand	103-107	5	1
β-strand	109	1	2
α-helix	111-113	3
α-helix	114-125	12
β-strand	134-138	5	1
α-helix	140-142	3
α-helix	148-151	4
β-strand	155-158	4	1
α-helix	167-169	3
α-helix	170-189	20
α-helix	192-193	2
β-strand	194	1	2
β-strand	202	1	1
β-strand	210-214	5	1
α-helix	224-231	8
α-helix	234-240	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
27.5 kDa virulence protein	A	protein	241	Salmonella enteritidis	P0A2N1 (AlphaFold model)
Mitogen-activated protein kinase 7	B	protein	9	Homo Sapiens	Q13164 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q8Y_1 27.5 kDa virulence protein (chains A)
MPINRPNLNLNIPPLNIVAAYDGAEIPSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPD
YSGMRQSGFFAMSQGFQLNNHGYDVFIHARRESPQSQGKFAGDKFHISVLRDMVPQAFQA
LSGLLFSEDSPVDKWAVTDMEKVVQQARVSLGAQFTLYIKPDQENSQYSASFLHKTRQFI
ECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGEMQRQALREEPFYRLMT
E

Sequence of entity 2 (B), FASTA

>2Q8Y_2 Mitogen-activated protein kinase 7 (chains B)
QYFMTEYVA

Primary citation

Structural insights into the enzymatic mechanism of the pathogenic MAPK phosphothreonine lyase. Zhu, Y., Li, H., Long, C. et al. Mol Cell (2007) 28:899-913. DOI 10.1016/j.molcel.2007.11.011 · PubMed

Other PDB entries of the same protein (UniProt P0A2N1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2P1W 2.3 Å, structure of the phosphothreonine lyase SpvC, the effector protein from Salmonella

Browse structure collections

About this viewer

MolViewer shows 2Q8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.