Distal C2-Like Domain of Human Calpain-7. Determined by X-ray diffraction at 1.45 Å resolution. Released 10 Jul 2007.
Explore 2QFE in 3D Show helices and sheets RCSB PDB PDBe
2QFE contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 676 | 1 | 1 |
| β-strand | 688-696 | 9 | 1 |
| α-helix | 698-700 | 3 | |
| α-helix | 711-713 | 3 | |
| β-strand | 717-721 | 5 | 2 |
| β-strand | 725-732 | 8 | 1 |
| β-strand | 738-747 | 10 | 2 |
| β-strand | 759-761 | 3 | 2 |
| β-strand | 766-767 | 2 | 2 |
| β-strand | 769-777 | 9 | 1 |
| α-helix | 778 | 1 | |
| β-strand | 780-788 | 9 | 2 |
| β-strand | 795-803 | 9 | 1 |
| β-strand | 808-811 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calpain-7 | A | protein | 148 | Homo sapiens | Q9Y6W3 (AlphaFold model) |
>2QFE_1 Calpain-7 (chains A) MGSSHHHHHHSSGLVPRGSPYTLSKRINGKWSGQSAGGCGNFQETHKNNPIYQFHIEKTG PLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNII PSTFLPKQEGPFFLDFNSIIPIKITQLQ
Structure of the C2 Domain of Human Calpain-7. Walker, J.R., Cuerrier, D., Ravulapalli, R. et al. To be published.
Other PDB entries of the same protein (UniProt Q9Y6W3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2QFE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.