8UC6: Calpain-7:IST1 Complex

Calpain-7:IST1 Complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 25 Oct 2023.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,821
Mol. weight: 47.01 kDa
Released: 25 Oct 2023

Explore 8UC6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UC6 contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-22	20
α-helix	26-45	20
α-helix	53-68	16
α-helix	79-102	24
α-helix	106-124	19
α-helix	130-151	22

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-22	20
α-helix	26-45	20
α-helix	53-68	16
α-helix	78-102	25
α-helix	106-124	19
α-helix	130-151	22

Chains E and G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	325-329	5
α-helix	352-362	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calpain-7	B, C	protein	165	Homo sapiens	Q9Y6W3 (AlphaFold model)
IST1 homolog	E, G	protein	45	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>8UC6_1 Calpain-7 (chains B, C)
MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEY
LERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLC
LKTSYETADKVLQNKLKQLARQALDRAEALSEPLTKPVGKISSTS

Sequence of entity 2 (E, G), FASTA

>8UC6_2 IST1 homolog (chains E, G)
NFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKKT

Primary citation

The Calpain-7 protease functions together with the ESCRT-III protein IST1 within the midbody to regulate the timing and completion of abscission. Paine, E.L., Skalicky, J.J., Whitby, F.G. et al. Elife (2023) 12. DOI 10.7554/eLife.84515 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6W3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QFE 1.45 Å, Distal C2-Like Domain of Human Calpain-7

Browse structure collections

About this viewer

MolViewer shows 8UC6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.