2QKQ: SAM Domain of Human Ephrin Type-B Receptor 4

Structure of the SAM Domain of Human Ephrin Type-B Receptor 4. Determined by X-ray diffraction at 2.1 Å resolution. Released 24 Jul 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 983
Mol. weight: 18.17 kDa
Released: 24 Jul 2007

Explore 2QKQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QKQ contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	912-918	7
α-helix	922-924	3
α-helix	925-930	6
α-helix	936-939	4
α-helix	944-950	7
α-helix	955-965	11

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	912-918	7
α-helix	922-924	3
α-helix	925-931	7
α-helix	936-939	4
α-helix	944-950	7
α-helix	955-965	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-B receptor 4	A, B	protein	83	Homo sapiens	P54760 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QKQ_1 Ephrin type-B receptor 4 (chains A, B)
GHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTL
AGHQKKILASVQHMKSQAKPGTP

Primary citation

SAM Domain of Human Ephrin Type-B Receptor 4 (EPHB4). Walker, J.R., Cuerrier, D., Butler-Cole, C. et al. To be published.

Other PDB entries of the same protein (UniProt P54760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FNK 1.05 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with a…
6FNM 1.16 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with Dasatinib
6FNJ 1.24 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with an isomer of…
6FNL 1.27 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase
6FNI 1.47 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with NVP-BHG712
2BBA 1.65 Å, Crystal Structure and Thermodynamic Characterization of the EphB4 Receptor in Complex…
2VWX 1.65 Å, ephB4 kinase domain inhibitor complex
2VWY 1.65 Å, ephB4 kinase domain inhibitor complex
2VWZ 1.65 Å, ephB4 kinase domain inhibitor complex
2VX1 1.65 Å, ephB4 kinase domain inhibitor complex
4BB4 1.65 Å, ephB4 kinase domain inhibitor complex
2XVD 1.7 Å, ephB4 kinase domain inhibitor complex

Browse structure collections

About this viewer

MolViewer shows 2QKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.