2QTS: Acid-sensing ion channel 1

Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH. Determined by X-ray diffraction at 1.9 Å resolution. Released 25 Sept 2007.

Method

X-ray diffraction

Resolution

1.9 Å

Organism

Gallus gallus

Chains

6

Atoms

22,034

Mol. weight

304.82 kDa

Ligands

NAG

Released

25 Sept 2007

Explore 2QTS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QTS contains 154 α-helices and 114 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 19 β-strands

Molecules and chains

>2QTS_1 Acid-sensing ion channel (chains A, B, C, D, E, F)
STLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATR
LTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANF
RNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGK
PRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFG
VAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCR
MVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKAS
AKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGAS
ILTVLELFDYAYEVIKHR

Ligands and cofactors

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure of acid-sensing ion channel 1 at 1.9A resolution and low pH. Jasti, J., Furukawa, H., Gonzales, E.B. et al. Nature (2007) 449:316-323. DOI 10.1038/nature06163 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
• 4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
• 3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
• 4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
• 4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
• 6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
• 5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
• 3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
• 3IJ4 3.0 Å, Cesium sites in the crystal structure of a functional acid sensing ion channel in the…
• 4NYK 3.0 Å, Structure of a membrane protein
• 6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…
• 5WKV 3.2 Å, Structure of an acid sensing ion channel in a resting state with calcium

Browse more

2QTS is part of these collections:

• Ion channels

About this viewer

MolViewer shows 2QTS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.