3IJ4: Amiloride-sensitive cation channel 2, neuronal

Cesium sites in the crystal structure of a functional acid sensing ion channel in the desensitized state. Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Nov 2009.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Gallus gallus
Chains: 1
Atoms: 3,249
Mol. weight: 53.66 kDa
Ligands: CS
Released: 10 Nov 2009

Explore 3IJ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IJ4 contains 24 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	54-70	17
β-strand	74-81	8	1
β-strand	86-87	2	2
α-helix	88	1
β-strand	90-95	6	3
β-strand	100	1	4
α-helix	106-112	7
α-helix	135-141	7
α-helix	155-162	8
α-helix	166-169	4
β-strand	170-175	6	1
β-strand	178-179	2	1
α-helix	180	1
α-helix	182-184	3
β-strand	185-189	5	3
β-strand	194-198	5	3
β-strand	209-210	2	2
α-helix	215-217	3
β-strand	219-224	6	1
α-helix	227-229	3
β-strand	230	1	4
α-helix	231-232	2
β-strand	246-251	6	3
α-helix	259-262	4
β-strand	264-266	3	3
β-strand	270-282	13	1
β-strand	291-292	2	5
α-helix	293	1
β-strand	298	1	6
β-strand	301	1	6
α-helix	306-322	17
β-strand	325	1	7
α-helix	334	1
β-strand	335	1	7
α-helix	336-337	2
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-350	5
α-helix	351-355	5
α-helix	363	1
β-strand	364-365	2	5
β-strand	367-379	13	1
α-helix	386-392	7
α-helix	397-403	7
β-strand	404-423	20	1
α-helix	427-441	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amiloride-sensitive cation channel 2, neuronal	A	protein	465	Gallus gallus	Q1XA76 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IJ4_1 Amiloride-sensitive cation channel 2, neuronal (chains A)
MDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALV
CTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNN
RYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCS
PEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFY
DTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCV
CEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQ
KKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCR

Ligands and cofactors

ID	Name	Formula	Copies
CS	Cesium ion	Cs	4

Water and common crystallization additives (CL) are not listed.

Primary citation

Pore architecture and ion sites in acid-sensing ion channels and P2X receptors. Gonzales, E.B., Kawate, T., Gouaux, E. Nature (2009) 460:599-604. DOI 10.1038/nature08218 · PubMed

Other PDB entries of the same protein (UniProt Q1XA76 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QTS 1.9 Å, Structure of an acid-sensing ion channel 1 at 1.9 A resolution and low pH
4NTW 2.07 Å, Structure of acid-sensing ion channel in complex with snake toxin
4NTX 2.27 Å, Structure of acid-sensing ion channel in complex with snake toxin and amiloride
3S3W 2.6 Å, Structure of chicken acid-sensing ion channel 1 at 2.6 a resolution and ph 7.5
4NTY 2.65 Å, Cesium sites in the crystal structure of acid-sensing ion channel in complex with snake…
4FZ0 2.8 Å, Crystal structure of acid-sensing ion channel in complex with psalmotoxin 1 at low pH
6VTK 2.82 Å, Structure of an acid-sensing ion channel solubilized by styrene maleic acid and in a…
5WKU 2.95 Å, Structure of an acid sensing ion channel in a resting state with barium
3S3X 2.99 Å, Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with…
4NYK 3.0 Å, Structure of a membrane protein
6X9H 3.01 Å, Molecular mechanism and structural basis of small-molecule modulation of acid-sensing…
5WKV 3.2 Å, Structure of an acid sensing ion channel in a resting state with calcium

Browse structure collections

About this viewer

MolViewer shows 3IJ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.