A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway. Determined by X-ray diffraction at 2.4 Å resolution. Released 21 Aug 2007.
Explore 2QV2 in 3D Show helices and sheets RCSB PDB PDBe
2QV2 contains 15 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-18 | 7 | 1 |
| β-strand | 24-25 | 2 | 2 |
| β-strand | 56-59 | 4 | 2 |
| β-strand | 74-77 | 4 | 2 |
| α-helix | 84-89 | 6 | |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 110-116 | 7 | 1 |
| α-helix | 125-128 | 4 | |
| α-helix | 137-139 | 3 | |
| α-helix | 171-173 | 3 | |
| α-helix | 177-189 | 13 | |
| α-helix | 203-215 | 13 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244 | 1 | 3 |
| α-helix | 246-248 | 3 | |
| α-helix | 249-255 | 7 | |
| α-helix | 259-267 | 9 | |
| α-helix | 271-288 | 18 | |
| α-helix | 291-294 | 4 | |
| α-helix | 298-309 | 12 | |
| β-strand | 310 | 1 | 3 |
| α-helix | 314-316 | 3 | |
| α-helix | 322-337 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Inositol polyphosphate 5-phosphatase OCRL-1 | A | protein | 342 | Homo sapiens | Q01968 (AlphaFold model) |
>2QV2_1 Inositol polyphosphate 5-phosphatase OCRL-1 (chains A) GPLGSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKPWLRAEP FEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISGNYLPSC FGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVPKEIW LLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFLEALP EPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNSVNANM IATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED
A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway. Erdmann, K.S., Mao, Y., McCrea, H.J. et al. Dev Cell (2007) 13:377-390. DOI 10.1016/j.devcel.2007.08.004 · PubMed
Other PDB entries of the same protein (UniProt Q01968 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2QV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.