2QY9: NG+1 construct of the E. coli SRP receptor FtsY

Structure of the NG+1 construct of the E. coli SRP receptor FtsY. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Oct 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,535
Mol. weight: 34 kDa
Released: 2 Oct 2007

Explore 2QY9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QY9 contains 18 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	197-202	6
α-helix	213-218	6
β-strand	222	1	1
α-helix	225-237	13
α-helix	242-258	17
β-strand	263	1	1
α-helix	264-266	3
α-helix	267-280	14
α-helix	284-286	3
β-strand	294-299	6	2
α-helix	306-318	13
β-strand	324-327	4	2
α-helix	334-346	13
β-strand	351-352	2	2
α-helix	360-373	14
β-strand	378-381	4	2
α-helix	387-389	3
α-helix	390-404	15
β-strand	414-420	7	2
α-helix	421-423	3
α-helix	425-437	13
β-strand	442-446	5	2
α-helix	456-464	9
β-strand	468-472	5	2
α-helix	477-479	3
β-strand	480-482	3	2
α-helix	483	1
α-helix	485-493	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein ftsY	A	protein	309	Escherichia coli	P10121 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QY9_1 Cell division protein ftsY (chains A)
MFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTE
GASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLA
RQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKAR
NIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLF
HEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFA
REDHHHHHH

Primary citation

The E. coli SRP-receptor FTSY contains an essential and autonomous membrane-binding amphipathic helix. Parlitz, R., Bange, G., Wild, K. et al. To be published.

Other PDB entries of the same protein (UniProt P10121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N9B 1.22 Å, FtsY-NG ultra high-resolution
6N5J 1.37 Å, FtsY-NG high-resolution
6CQP 1.45 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6N5I 1.5 Å, FtsY-NG high-resolution
6NC1 1.6 Å, FtsY-NG high-resolution
2YHS 1.6 Å, Structure of the E. coli SRP receptor FtsY
6NC4 1.6 Å, FtsY-NG high-resolution
5NIY 1.7 Å, Signal recognition particle-docking protein FtsY
6CS8 1.75 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6CVD 1.78 Å, High resolution crystal structure of FtsY-NG domain of E. coli bound to fragment 1
6DLX 1.85 Å, FtsY-NG domain bound to fragment 3.
6N6N 1.88 Å, FtsY-NG high-resolution

Browse structure collections

About this viewer

MolViewer shows 2QY9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.