Crystal structure of Salmonella effector protein SopA. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Dec 2007.
Explore 2QYU in 3D Show helices and sheets RCSB PDB PDBe
2QYU contains 40 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 170-185 | 16 | |
| α-helix | 188-191 | 4 | |
| β-strand | 196 | 1 | 1 |
| β-strand | 201 | 1 | 2 |
| β-strand | 206 | 1 | 3 |
| α-helix | 207-209 | 3 | |
| α-helix | 213-216 | 4 | |
| β-strand | 223-224 | 2 | 1 |
| β-strand | 227 | 1 | 1 |
| β-strand | 232 | 1 | 2 |
| β-strand | 237 | 1 | 3 |
| β-strand | 242-244 | 3 | 1 |
| β-strand | 247 | 1 | 1 |
| β-strand | 252 | 1 | 2 |
| β-strand | 257 | 1 | 3 |
| β-strand | 262-264 | 3 | 1 |
| β-strand | 267 | 1 | 1 |
| β-strand | 272-273 | 2 | 2 |
| α-helix | 282-283 | 2 | |
| β-strand | 284-289 | 6 | 1 |
| β-strand | 294-295 | 2 | 2 |
| β-strand | 300-305 | 6 | 1 |
| α-helix | 306 | 1 | |
| α-helix | 312-316 | 5 | |
| β-strand | 323-326 | 4 | 2 |
| β-strand | 329-332 | 4 | 2 |
| α-helix | 333-334 | 2 | |
| α-helix | 339-346 | 8 | |
| α-helix | 356-361 | 6 | |
| α-helix | 365-367 | 3 | |
| α-helix | 368-383 | 16 | |
| α-helix | 389-392 | 4 | |
| α-helix | 393-395 | 3 | |
| α-helix | 396-403 | 8 | |
| α-helix | 408-410 | 3 | |
| α-helix | 412-433 | 22 | |
| α-helix | 437-439 | 3 | |
| α-helix | 443-444 | 2 | |
| α-helix | 445-449 | 5 | |
| α-helix | 450-459 | 10 | |
| α-helix | 463-466 | 4 | |
| α-helix | 468-480 | 13 | |
| α-helix | 486-501 | 16 | |
| α-helix | 506-508 | 3 | |
| β-strand | 531-534 | 4 | 4 |
| β-strand | 541-545 | 5 | 4 |
| α-helix | 547-554 | 8 | |
| β-strand | 566-569 | 4 | 4 |
| β-strand | 572-574 | 3 | 4 |
| α-helix | 581-588 | 8 | |
| α-helix | 590-612 | 23 | |
| α-helix | 619-628 | 10 | |
| α-helix | 641-651 | 11 | |
| α-helix | 652-654 | 3 | |
| α-helix | 656-658 | 3 | |
| α-helix | 662-671 | 10 | |
| α-helix | 679-696 | 18 | |
| α-helix | 710-726 | 17 | |
| α-helix | 728-730 | 3 | |
| α-helix | 734-744 | 11 | |
| α-helix | 756-768 | 13 | |
| α-helix | 770-776 | 7 | |
| α-helix | 779-781 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Secreted effector protein | A | protein | 627 | Salmonella typhimurium | Q8ZNR3 (AlphaFold model) |
>2QYU_1 Secreted effector protein (chains A) MHHHHHHATSSPSSPADWAKKLTDAVLRQKAGETLTAADRDFSNADFRNITFSKILPPSF MERDGDIIKGFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSNTKFSNSDMNEVFLQY SITTQQQPSFIDTTLKNTLIRHKANLSGVILNEPDNSSPPSVSGGGNFIRLGDIWLQMPL LWTENAVDGFLNHEHNNGKSILMTIDSLPDKYSQEKVQAMEDLVKSLRGGRLTEACIRPV ESSLVSVLAHPPYTQSALISEWLGPVQERFFAHQCQTYNDVPLPAPDTYYQQRILPVLLD SFDRNSAAMTTHSGLFNQVILHCMTGVDCTDGTRQKAAALYEQYLAHPAVSPHIHNGLFG NYDGSPDWTTRAADNFLLLSSQDSDTAMMLSTDTLLTMLNPTPDTAWDNFYLLRAGENVS TAQISPVELFRHDFPVFLAAFNQQATQRRFGELIDIILSTEEHGELNQQFLAATNQKHST VKLIDDASVSRLATIFDPLLPEGKLSPAHYQHILSAYHLTDATPQKQAETLFCLSTAFAR YSSSAIFGTEHDSPPALRGYAEALMQKAWELSPAIFPSSEQFTEWSDRFHGLHGAFTCTS VVADSMQRHARKYFPSVLSSILPLAWA
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| B3P | 2-[3-(2-hydroxy-1,1-dihydroxymethyl-ethylamino)-propylamino]-2-hydroxymethyl-pr… | C11 H26 N2 O6 | 1 |
Crystal structure of SopA, a Salmonella effector protein mimicking a eukaryotic ubiquitin ligase. Diao, J., Zhang, Y., Huibregtse, J.M. et al. Nat Struct Mol Biol (2008) 15:65-70. DOI 10.1038/nsmb1346 · PubMed
Other PDB entries of the same protein (UniProt Q8ZNR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2QYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.