2R0K: Protease domain of HGFA with inhibitor Fab58

Protease domain of HGFA with inhibitor Fab58. Determined by X-ray diffraction at 3.51 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 3.51 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,042
Mol. weight: 77.86 kDa
Released: 25 Dec 2007

Explore 2R0K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R0K contains 20 α-helices and 71 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
β-strand	30-35	6	3
β-strand	40-46	7	3
β-strand	51-54	4	3
α-helix	56-58	3
α-helix	61-63	3
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	104-108	5	3
α-helix	109-110	2
β-strand	115	1	5
β-strand	118	1	5
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-162	7	2
α-helix	163-164	2
α-helix	165-169	5
α-helix	173-175	3
β-strand	182-183	2	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	206-215	10	2
β-strand	221	1	6
β-strand	224	1	6
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-239	5

Chain H: 4 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	12
β-strand	11-12	2	13
β-strand	17-25	9	12
β-strand	33-39	7	14
β-strand	45-52	8	14
β-strand	56-59	4	14
β-strand	67-72	6	12
β-strand	77-82A	7	12
α-helix	84-86	3
β-strand	88-95	8	14
β-strand	100-103	4	14
β-strand	107-109	3	14
β-strand	110-111	2	13
β-strand	117	1	15
α-helix	118-119	2
β-strand	120	1	16
β-strand	123-124	2	17
β-strand	135-140	6	17
β-strand	143-145	3	16
β-strand	146	1	15
β-strand	151-154	4	18
β-strand	163-165	3	17
α-helix	166-168	3
β-strand	169-171	3	16
β-strand	175-177	3	16
β-strand	180-185	6	17
β-strand	189	1	19
β-strand	192	1	19
β-strand	194-200	7	18
α-helix	201-203	3
β-strand	205-211	7	18

Chain L: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
β-strand	62-66	5	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
α-helix	96	1
β-strand	98	1	8
β-strand	103-107	5	8
β-strand	111	1	9
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	10
β-strand	140	1	9
β-strand	145-150	6	11
β-strand	153-154	2	11
β-strand	161-163	3	10
α-helix	164-167	4
β-strand	173-181	9	10
α-helix	183-187	5
β-strand	191-197	7	11
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hepatocyte growth factor activator	A	protein	283	Homo sapiens	Q04756 (AlphaFold model)
antibody light chain of Fab58	L	protein	214	Homo sapiens
antibody heavy chain of Fab58, Fab portion only	H	protein	225	Homo sapiens

Sequence of entity 1 (A), FASTA

>2R0K_1 Hepatocyte growth factor activator (chains A)
VQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGDSFC
AGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFN
PSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSS
SLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYL
YGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS

Sequence of entity 2 (L), FASTA

>2R0K_2 antibody light chain of Fab58 (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (H), FASTA

>2R0K_3 antibody heavy chain of Fab58, Fab portion only (chains H)
EVQLVESGGGLVQPGGSLRLSCAASGFTITGSAIHWVRQAPGKGLEWVAIINPNGGYTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSARFSFDYWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Primary citation

Structural insight into distinct mechanisms of protease inhibition by antibodies. Wu, Y., Eigenbrot, C., Liang, W.C. et al. Proc Natl Acad Sci U S A (2007) 104:19784-19789. DOI 10.1073/pnas.0708251104 · PubMed

Other PDB entries of the same protein (UniProt Q04756 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R0L 2.2 Å, Short Form HGFA with Inhibitory Fab75
3K2U 2.35 Å, Crystal structure of HGFA in complex with the allosteric inhibitory antibody Fab40
1YC0 2.6 Å, short form HGFA with first Kunitz domain from HAI-1
1YBW 2.7 Å, Protease domain of HGFA with no inhibitor
2WUC 2.7 Å, Crystal structure of HGFA in complex with the allosteric non- inhibitory antibody…
2WUB 2.9 Å, Crystal structure of HGFA in complex with the allosteric non- inhibitory antibody…

Browse structure collections

About this viewer

MolViewer shows 2R0K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.