Crystal structure of S25-2 Fab in complex with Kdo analogues. Determined by X-ray diffraction at 1.7 Å resolution. Released 30 Dec 2008.
Explore 2R1W in 3D Show helices and sheets RCSB PDB PDBe
2R1W contains 16 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 30 | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 96-97 | 2 | 2 |
| β-strand | 101-106 | 6 | 2 |
| β-strand | 110 | 1 | 4 |
| α-helix | 111-112 | 2 | |
| β-strand | 113-117 | 5 | 5 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-124 | 4 | |
| β-strand | 128-138 | 11 | 5 |
| β-strand | 139 | 1 | 4 |
| β-strand | 144-149 | 6 | 6 |
| β-strand | 152 | 1 | 6 |
| β-strand | 158-162 | 5 | 5 |
| α-helix | 163-166 | 4 | |
| β-strand | 172-181 | 10 | 5 |
| α-helix | 182-185 | 4 | |
| β-strand | 190-196 | 7 | 6 |
| α-helix | 203 | 1 | |
| β-strand | 204-209 | 6 | 6 |
| α-helix | 210-212 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 9 |
| β-strand | 46-51 | 6 | 9 |
| α-helix | 52B-52D | 3 | |
| β-strand | 55-57 | 3 | 9 |
| β-strand | 62 | 1 | 7 |
| β-strand | 65-70 | 6 | 7 |
| β-strand | 75-80 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 9 |
| β-strand | 101 | 1 | 9 |
| β-strand | 105-107 | 3 | 9 |
| β-strand | 108-109 | 2 | 8 |
| α-helix | 112-114 | 3 | |
| β-strand | 115 | 1 | 10 |
| α-helix | 116-117 | 2 | |
| β-strand | 118-122 | 5 | 11 |
| β-strand | 133-143 | 11 | 11 |
| β-strand | 144 | 1 | 10 |
| β-strand | 149-152 | 4 | 12 |
| α-helix | 153-155 | 3 | |
| β-strand | 157 | 1 | 12 |
| β-strand | 161-169 | 9 | 11 |
| β-strand | 172-182 | 11 | 11 |
| β-strand | 192-197 | 6 | 12 |
| α-helix | 198-200 | 3 | |
| β-strand | 202-207 | 6 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab, antibody fragment (IgG1k), light chain | A | protein | 219 | Mus musculus | P01837 (AlphaFold model) |
| Fab, antibody fragment (IgG1k), heavy chain | B | protein | 222 | Mus musculus | A2NU21 (AlphaFold model) |
>2R1W_1 Fab, antibody fragment (IgG1k), light chain (chains A) DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR ESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>2R1W_2 Fab, antibody fragment (IgG1k), heavy chain (chains B) EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTT EYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTV SAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQ SDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes. Brooks, C.L., Muller-Loennies, S., Brade, L. et al. J Mol Biol (2008) 377:450-468. DOI 10.1016/j.jmb.2008.01.018 · PubMed
Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2R1W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.