2RII: Human Peroxiredoxin I

Crystal Structure of Human Peroxiredoxin I in complex with Sulfiredoxin. Determined by X-ray diffraction at 2.6 Å resolution. Released 8 Jan 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,485
Mol. weight: 68.53 kDa
Ligands: PO4
Released: 8 Jan 2008

Explore 2RII in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RII contains 28 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	16-20	5	2
β-strand	26-30	5	2
α-helix	31-34	4
β-strand	38-43	6	2
α-helix	54-61	8
α-helix	63-67	5
β-strand	71-77	7	2
α-helix	81-88	8
α-helix	92-94	3
β-strand	104-106	3	2
α-helix	111-116	6
β-strand	119-120	2	3
β-strand	125-126	2	3
β-strand	128-133	6	2
β-strand	138	1	1
β-strand	139-145	7	2
α-helix	153-167	15
β-strand	184	1	4

Chain B: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	5
α-helix	12-14	3
β-strand	16-20	5	2
β-strand	26-30	5	2
α-helix	31-34	4
β-strand	38-43	6	2
α-helix	54-61	8
α-helix	63-67	5
β-strand	71-77	7	2
α-helix	81-89	9
β-strand	104-106	3	2
α-helix	111-115	5
β-strand	119-120	2	6
β-strand	125-126	2	6
β-strand	128-133	6	2
β-strand	138	1	5
β-strand	139-145	7	2
α-helix	153-168	16
α-helix	181-183	3
β-strand	184	1	7

Chain X: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	7
α-helix	46-48	3
β-strand	49-50	2	7
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	7
β-strand	91-95	5	7
α-helix	99-107	9
β-strand	112-120	9	7
α-helix	123-129	7
α-helix	130-132	3

Chain Y: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	4
β-strand	49-50	2	4
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	4
β-strand	91-95	5	4
α-helix	99-107	9
β-strand	112-120	9	4
α-helix	123-129	7
α-helix	130-132	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxiredoxin-1	A, B	protein	199	Homo sapiens	Q06830 (AlphaFold model)
Sulfiredoxin-1	X, Y	protein	110	Homo sapiens	Q9BYN0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2RII_1 Peroxiredoxin-1 (chains A, B)
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPG
SDTIKPDVQKSKEYFSKQK

Sequence of entity 2 (X, Y), FASTA

>2RII_2 Sulfiredoxin-1 (chains X, Y)
GHPMSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGA
QGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

Structure of the sulphiredoxin-peroxiredoxin complex reveals an essential repair embrace. Jonsson, T.J., Johnson, L.C., Lowther, W.T. Nature (2008) 451:98-101. DOI 10.1038/nature06415 · PubMed

Other PDB entries of the same protein (UniProt Q06830 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Z54 1.45 Å, Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment
9VQ5 1.5 Å, Crystal structure of Peroxiredoxin I in complex with SAC
8X71 1.58 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-064
8X73 1.61 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-069
9LNH 1.63 Å, Crystal structure of Peroxiredoxin I in complex with compound LC-PDin20
9B7A 1.71 Å, Crystal structure of peroxiredoxin 1 with RA
7WET 1.76 Å, Crystal structure of Peroxiredoxin I in complex with the inhibitor Cela
9VGT 1.79 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-150
9VE2 1.8 Å, Crystal Structure of Human Peroxiredoxin I in Complex with Fluvastatin
8Z56 1.81 Å, Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment
7WEU 1.81 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-048
9LG0 1.81 Å, Crystal Structure of Human Peroxiredoxin I in Complex with SAB

Browse structure collections

About this viewer

MolViewer shows 2RII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.