2RNN: E3 SUMO-protein ligase SIZ1

Name: PDB 2RNN: Solution Structure of the N-terminal SAP Domain of SUMO E3 Ligases from Saccharomyces cerevisiae
Published: 2008-12-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Solution Structure of the N-terminal SAP Domain of SUMO E3 Ligases from Saccharomyces cerevisiae. Determined by solution NMR. Released 30 Dec 2008.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 930
Mol. weight: 13.24 kDa
Released: 30 Dec 2008

Explore 2RNN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RNN contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	4-6	3
α-helix	21-34	14
α-helix	39-48	10
α-helix	57-70	14
α-helix	79-94	16
α-helix	101-110	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 SUMO-protein ligase SIZ1	A	protein	114	Saccharomyces cerevisiae	Q04195 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RNN_1 E3 SUMO-protein ligase SIZ1 (chains A)
GSHMINLEDYWEDETPGPDREPTNELRNEVEETITLMELLKVSELKDICRSVSFPVSGRK
AVLQDLIRNFLQNALVVGKSDPYRVQAVKFLIERIRKNEPLPVYKDLWNALRKG

Primary citation

Solution structures and DNA binding properties of the N-terminal SAP domains of SUMO E3 ligases from Saccharomyces cerevisiae and Oryza sativa. Suzuki, R., Shindo, H., Tase, A. et al. Proteins (2009) 75:336-347. DOI 10.1002/prot.22243 · PubMed

Other PDB entries of the same protein (UniProt Q04195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3I2D 2.6 Å, Crystal Structure of S. Cerevisiae SUMO E3 Ligase SIZ1
5JNE 2.85 Å, E2-SUMO-Siz1 E3-SUMO-PCNA complex

Browse structure collections

About this viewer

MolViewer shows 2RNN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.