Crystal Structure of S. Cerevisiae SUMO E3 Ligase SIZ1. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Sept 2009.
Explore 3I2D in 3D Show helices and sheets RCSB PDB PDBe
3I2D contains 13 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 173-175 | 3 | |
| β-strand | 177 | 1 | 1 |
| α-helix | 178-179 | 2 | |
| β-strand | 180 | 1 | 2 |
| β-strand | 183-196 | 14 | 2 |
| β-strand | 199-209 | 11 | 3 |
| α-helix | 213-220 | 8 | |
| β-strand | 226-234 | 9 | 2 |
| α-helix | 241-243 | 3 | |
| β-strand | 244 | 1 | 1 |
| α-helix | 245-246 | 2 | |
| β-strand | 252-256 | 5 | 3 |
| β-strand | 259-260 | 2 | 3 |
| α-helix | 273-275 | 3 | |
| β-strand | 278-279 | 2 | 2 |
| α-helix | 281-283 | 3 | |
| α-helix | 284-286 | 3 | |
| β-strand | 291-300 | 10 | 3 |
| β-strand | 304-313 | 10 | 2 |
| α-helix | 316-324 | 9 | |
| β-strand | 329 | 1 | 4 |
| α-helix | 331-343 | 13 | |
| β-strand | 354-358 | 5 | 5 |
| β-strand | 360 | 1 | 6 |
| β-strand | 367 | 1 | 6 |
| β-strand | 371-374 | 4 | 7 |
| β-strand | 383-384 | 2 | 7 |
| α-helix | 385-394 | 10 | |
| β-strand | 399 | 1 | 8 |
| β-strand | 406 | 1 | 8 |
| α-helix | 409-411 | 3 | |
| β-strand | 412-414 | 3 | 7 |
| β-strand | 415 | 1 | 4 |
| α-helix | 416-422 | 7 | |
| β-strand | 431-435 | 5 | 5 |
| β-strand | 440-442 | 3 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 SUMO-protein ligase SIZ1 | A | protein | 371 | Saccharomyces cerevisiae | Q04195 (AlphaFold model) |
>3I2D_1 E3 SUMO-protein ligase SIZ1 (chains A) SLTPLSAITVRSMEGPPTVQQQSPSVIRQSPTQRRKTSTTSSTSRAPPPTNPDASSSSSS FAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLY LFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQ QNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDEEMG LTTTSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIAL ENLAISEFVDDILQNCQKNVEQVELTSDGKWTAILEDDDDSDSDSNDGSRSPEKGTLGEG AAALEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structure of the Siz/PIAS SUMO E3 ligase Siz1 and determinants required for SUMO modification of PCNA. Yunus, A.A., Lima, C.D. Mol Cell (2009) 35:669-682. DOI 10.1016/j.molcel.2009.07.013 · PubMed
Other PDB entries of the same protein (UniProt Q04195 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3I2D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.