2ROZ: C-terminal PID Domain of Fe65L1

Structure of the C-terminal PID Domain of Fe65L1 Complexed with the Cytoplasmic Tail of APP Reveals a Novel Peptide Binding Mode. Determined by solution NMR. Released 22 Jul 2008.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,296
Mol. weight: 18.59 kDa
Released: 22 Jul 2008

Explore 2ROZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ROZ contains 3 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-16	11
β-strand	20	1	1

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-27	9	2
α-helix	34-47	14
β-strand	55-61	7	2
β-strand	64-69	6	2
β-strand	76-80	5	2
β-strand	87	1	1
β-strand	88-89	2	2
β-strand	96	1	2
β-strand	98-101	4	2
β-strand	109-114	6	2
α-helix	120-130	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
peptide from Amyloid beta A4 protein	A	protein	32		P12023 (AlphaFold model)
Amyloid beta A4 precursor protein-binding family B member 2	B	protein	136	Mus musculus	Q9DBR4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ROZ_1 peptide from Amyloid beta A4 protein (chains A)
DAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Sequence of entity 2 (B), FASTA

>2ROZ_2 Amyloid beta A4 precursor protein-binding family B member 2 (chains B)
GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNV
ADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAA
NVSEAVQAACSGPSSG

Primary citation

Structure of the C-terminal phosphotyrosine interaction domain of Fe65L1 complexed with the cytoplasmic tail of amyloid precursor protein reveals a novel peptide binding mode. Li, H., Koshiba, S., Hayashi, F. et al. J Biol Chem (2008) 283:27165-27178. DOI 10.1074/jbc.M803892200 · PubMed

Other PDB entries of the same protein (UniProt P12023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MYK 1.6 Å, Structure of Pyroglutamate-Abeta-specific Fab c#17 in complex with murine Abeta-pE3-18PEGb
4YN0 2.2 Å, Crystal structure of APP E2 domain in complex with DR6 CRD domain
8S4Y 2.7 Å, Crystal structure of an APP-talin (F2F3) chimera
7MRN 3.5 Å, Mouse CNTN5 APP complex
8BG9 3.5 Å, Murine amyloid-beta filaments with the Arctic mutation (E22G) from APP(NL-G-F) mouse…

Browse structure collections

About this viewer

MolViewer shows 2ROZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.