2RT5: Msx2-interacting protein

Structural insights into the recruitment of SMRT by the co-repressor SHARP under phosphorylative regulation. Determined by solution NMR. Released 4 Dec 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,370
Mol. weight: 19.57 kDa
Released: 4 Dec 2013

Explore 2RT5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RT5 contains 10 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3498-3501	4
β-strand	3507-3515	9	1
β-strand	3518-3529	12	1
α-helix	3531-3537	7
α-helix	3545-3546	2
β-strand	3547-3548	2	1
β-strand	3551-3552	2	1
α-helix	3557-3567	11
β-strand	3570	1	1
β-strand	3573-3580	8	1
α-helix	3585-3595	11
α-helix	3596-3600	5
α-helix	3601-3606	6
β-strand	3610-3614	5	1
α-helix	3615-3616	2
β-strand	3624-3629	6	1
α-helix	3633-3642	10
α-helix	3644-3650	7
β-strand	3657-3663	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Msx2-interacting protein	A	protein	169	Homo sapiens	Q96T58
peptide from Silencing mediator of retinoic acid and thyroid hormone receptor	B	protein	8	Homo sapiens	Q9Y618 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RT5_1 Msx2-interacting protein (chains A)
VDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLSEGGPPLRIAQRMRL
EATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFITYLQAKQAAGIINVP
NPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVIASV

Sequence of entity 2 (B), FASTA

>2RT5_2 peptide from Silencing mediator of retinoic acid and thyroid hormone receptor (chains B)
YETLSDSE

Primary citation

Structural insights into the recruitment of SMRT by the corepressor SHARP under phosphorylative regulation. Mikami, S., Kanaba, T., Takizawa, N. et al. Structure (2014) 22:35-46. DOI 10.1016/j.str.2013.10.007 · PubMed

Other PDB entries of the same protein (UniProt Q96T58), best resolution first:

7Z1K 1.55 Å, Crystal structure of the SPOC domain of human SHARP (SPEN) in complex with RNA…
1OW1 1.8 Å, Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP.
4P6Q 2.0 Å, The crystal structure of the Split End protein SHARP adds a new layer of complexity to…

Browse structure collections

About this viewer

MolViewer shows 2RT5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.