4P6Q: Msx2-interacting protein

The crystal structure of the Split End protein SHARP adds a new layer of complexity to proteins containing RNA Recognition Motifs. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 May 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,483
Mol. weight: 33.15 kDa
Released: 14 May 2014

Explore 4P6Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P6Q contains 14 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	336-340	5	1
α-helix	348-359	12
α-helix	360-362	3
β-strand	365-371	7	1
β-strand	378-383	6	1
α-helix	386-395	10
β-strand	400-401	2	2
β-strand	404-405	2	2
β-strand	407-410	4	1
α-helix	411-413	3
α-helix	414-422	9
α-helix	424-426	3
β-strand	439-443	5	3
α-helix	451-458	8
β-strand	464-472	9	3
β-strand	475-483	9	3
α-helix	486-496	11
β-strand	500-501	2	4
β-strand	504-505	2	4
β-strand	507-510	4	3
α-helix	511-515	5
β-strand	518-522	5	5
α-helix	530-537	8
α-helix	538-540	3
β-strand	543-549	7	5
β-strand	554-559	6	5
α-helix	562-572	11
β-strand	576-577	2	6
β-strand	580-581	2	6
β-strand	583-586	4	5
α-helix	589-601	13
α-helix	609-618	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Msx2-interacting protein	A	protein	286	Homo sapiens	Q96T58

Sequence of entity 1 (A), FASTA

>4P6Q_1 Msx2-interacting protein (chains A)
FGIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALT
ASKGKLFFGMQIEVTAWIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDL
RNIFQRFGEIVDIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSM
PTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKG
RKIGGNKIKVDFANRESQLAFYHCMEKSGQDIRDFYEMLAERREER

Primary citation

The crystal structure of the Split End protein SHARP adds a new layer of complexity to proteins containing RNA recognition motifs. Arieti, F., Gabus, C., Tambalo, M. et al. Nucleic Acids Res (2014) 42:6742. DOI 10.1093/nar/gku277 · PubMed

Other PDB entries of the same protein (UniProt Q96T58), best resolution first:

7Z1K 1.55 Å, Crystal structure of the SPOC domain of human SHARP (SPEN) in complex with RNA…
1OW1 1.8 Å, Crystal structure of the SPOC domain of the human transcriptional corepressor, SHARP.
2RT5 Structural insights into the recruitment of SMRT by the co-repressor SHARP under…

Browse structure collections

About this viewer

MolViewer shows 4P6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.