Solution structure of rat P2X4 receptor head domain. Determined by solution NMR. Released 4 Feb 2015.
Explore 2RUP in 3D Show helices and sheets RCSB PDB PDBe
2RUP contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 114-117 | 4 | 1 |
| α-helix | 118-120 | 3 | |
| β-strand | 135 | 1 | 1 |
| β-strand | 144-150 | 7 | 1 |
| β-strand | 158-163 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| P2X purinoceptor 4 | A | protein | 58 | Rattus norvegicus | P51577 (AlphaFold model) |
>2RUP_1 P2X purinoceptor 4 (chains A) MQTQSTCPEIPDKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPV
Solution structure of the rat P2X4 receptor head domain involved in inhibitory metal binding. Igawa, T., Abe, Y., Tsuda, M. et al. FEBS Lett (2015) 589:680-686. DOI 10.1016/j.febslet.2015.01.034 · PubMed
Other PDB entries of the same protein (UniProt P51577 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.