Solution structure of the chromodomain of HP1a with the phosphorylated N-terminal tail complexed with H3K9me3 peptide. Determined by solution NMR. Released 16 Mar 2016.
Explore 2RVN in 3D Show helices and sheets RCSB PDB PDBe
2RVN contains 2 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20 | 1 | 1 |
| β-strand | 22-31 | 10 | 2 |
| β-strand | 34-41 | 8 | 2 |
| α-helix | 46-48 | 3 | |
| β-strand | 51-53 | 3 | 2 |
| α-helix | 60-73 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromobox protein homolog 5 | A | protein | 83 | Mus musculus | Q61686 (AlphaFold model) |
| 18-mer peptide of Histone H3 | B | protein | 18 | Mus musculus | P84244 (AlphaFold model) |
>2RVN_1 Chromobox protein homolog 5 (chains A) GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNL DCPELISEFMKKYKKMKEGENNK
>2RVN_2 18-mer peptide of Histone H3 (chains B) ARTKQTARKSTGGKAPRY
Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail. Shimojo, H., Kawaguchi, A., Oda, T. et al. Sci Rep (2016) 6:22527-22527. DOI 10.1038/srep22527 · PubMed
Other PDB entries of the same protein (UniProt Q61686 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RVN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.