2TCL: Catalytic domain of human fibroblast collagenase

Structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor. Determined by X-ray diffraction at 2.2 Å resolution. Released 8 Mar 1996.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,387
Mol. weight: 19.63 kDa
Ligands: RO4, CA, SM, ZN
Released: 8 Mar 1996

Explore 2TCL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2TCL contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
α-helix	27-43	17
β-strand	48-51	4	1
β-strand	59-64	6	1
β-strand	82-84	3	1
α-helix	85-86	2
β-strand	95-98	4	1
β-strand	104	1	2
β-strand	111	1	2
α-helix	112-123	12
α-helix	150-160	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast collagenase	A	protein	169	Homo sapiens	P03956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2TCL_1 FIBROBLAST COLLAGENASE (chains A)
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM
ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL
GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP

Ligands and cofactors

ID	Name	Formula	Copies
RO4	[[1-[N-hydroxy-acetamidyl]-3-methyl-butyl]-carbonyl-leucinyl]-alanine ethyl…	C19 H35 N3 O6	1
CA	Calcium ion	Ca	2
SM	Samarium (III) ion	Sm	1
ZN	Zinc ion	Zn	2

Primary citation

Structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor. Borkakoti, N., Winkler, F.K., Williams, D.H. et al. Nat Struct Biol (1994) 1:106-110. DOI 10.1038/nsb0294-106 · PubMed

Other PDB entries of the same protein (UniProt P03956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HFC 1.5 Å, 1.56 Å structure of mature truncated human fibroblast collagenase
1CGE 1.9 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
966C 1.9 Å, Crystal structure of fibroblast collagenase-1 complexed to a diphenyl-ether sulphone…
1CGF 2.1 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
1SU3 2.2 Å, X-ray structure of human proMMP-1: New insights into collagenase action
3SHI 2.2 Å, Crystal structure of human MMP1 catalytic domain at 2.2 A resolution
1CGL 2.4 Å, Structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor
2J0T 2.54 Å, Crystal Structure of the Catalytic Domain of MMP-1 in Complex with the Inhibitory Domain…
2CLT 2.67 Å, Crystal structure of the active form (full-length) of human fibroblast collagenase.
4AUO 3.0 Å, Crystal structure of MMP-1(E200A) in complex with a triple-helical collagen peptide
1AYK Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, 30 structures
2AYK Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, minimized…

Browse structure collections

About this viewer

MolViewer shows 2TCL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.