2UWQ: ASPP2 N-terminus

Solution structure of ASPP2 N-terminus. Determined by solution NMR. Released 10 Jul 2007.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 696
Mol. weight: 9.98 kDa
Released: 10 Jul 2007

Explore 2UWQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UWQ contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	17-22	6	1
β-strand	27	1	2
α-helix	29-34	6
β-strand	44-49	6	1
β-strand	52-56	5	1
β-strand	61	1	2
α-helix	62-69	8
α-helix	73-75	3
β-strand	77-81	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis-stimulating of P53 protein 2	A	protein	86	HOMO SAPIENS	Q13625 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2UWQ_1 APOPTOSIS-STIMULATING OF P53 PROTEIN 2 (chains A)
GGSMMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVA
DNERMFDVLQRFGSQRNEVRFFLRHE

Primary citation

Solution structure of ASPP2 N-terminal domain (N-ASPP2) reveals a ubiquitin-like fold. Tidow, H., Andreeva, A., Rutherford, T.J. et al. J Mol Biol (2007) 371:948-958. DOI 10.1016/j.jmb.2007.05.024 · PubMed

Other PDB entries of the same protein (UniProt Q13625 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HKP 1.9 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and ASPP2 (970-992)
4IRV 2.04 Å, Structure of the Helicobacter pylori CagA Oncogene Bound to the Human Tumor Suppressor…
6GHM 2.15 Å, Structure of PP1 alpha phosphatase bound to ASPP2
1YCS 2.2 Å, P53-53BP2 complex
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution

Browse structure collections

About this viewer

MolViewer shows 2UWQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.