2UYY: Cytokine-like nuclear factor n-pac

Name: PDB 2UYY: Structure of the cytokine-like nuclear factor n-pac
Published: 2007-07-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Structure of the cytokine-like nuclear factor n-pac. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 9,183
Mol. weight: 137.75 kDa
Ligands: NA7
Released: 3 Jul 2007

Explore 2UYY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UYY contains 77 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	263-266	4
β-strand	270-273	4	1
α-helix	277-288	12
β-strand	293-296	4	1
α-helix	300-303	4
α-helix	304-308	5
α-helix	311	1
β-strand	312-313	2	1
α-helix	314	1
α-helix	317-323	7
β-strand	326-329	4	1
α-helix	334-342	9
α-helix	347-350	4
β-strand	356-359	4	1
α-helix	365-377	13
β-strand	381-384	4	1
β-strand	387-388	2	2
α-helix	391-396	6
β-strand	399-403	5	2
β-strand	404-405	2	1
α-helix	407-412	6
α-helix	414-420	7
β-strand	421-426	6	2
α-helix	432-460	29
α-helix	465-474	10
α-helix	480-491	12
β-strand	499	1	3
α-helix	500-516	17
α-helix	522-536	15
β-strand	543	1	3
α-helix	544-550	7

Chain B: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	263-266	4
α-helix	269	1
β-strand	270-273	4	4
α-helix	279-288	10
β-strand	293-296	4	4
α-helix	300-306	7
α-helix	311	1
β-strand	312-313	2	4
α-helix	314	1
α-helix	317-323	7
β-strand	326-329	4	4
α-helix	334-342	9
α-helix	347-350	4
β-strand	356-359	4	4
α-helix	365-377	13
β-strand	381-384	4	4
β-strand	387-388	2	5
α-helix	391-396	6
β-strand	399-403	5	5
β-strand	404-405	2	4
α-helix	407-412	6
α-helix	414-420	7
β-strand	421-426	6	5
α-helix	432-460	29
α-helix	465-474	10
α-helix	480-491	12
β-strand	499	1	6
α-helix	500-516	17
α-helix	522-536	15
β-strand	543	1	6
α-helix	544-550	7

Chain C: 20 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	263-266	4
α-helix	269	1
β-strand	270-273	4	7
α-helix	277-288	12
β-strand	293-296	4	7
α-helix	300-303	4
α-helix	304-308	5
α-helix	311	1
β-strand	312-313	2	7
α-helix	314	1
α-helix	317-323	7
β-strand	326-329	4	7
α-helix	334-342	9
α-helix	347-350	4
β-strand	356-359	4	7
α-helix	365-377	13
β-strand	381-384	4	7
β-strand	387-388	2	8
α-helix	391-395	5
β-strand	399-403	5	8
β-strand	404-405	2	7
α-helix	407-412	6
α-helix	414-420	7
β-strand	421-426	6	8
α-helix	432-460	29
α-helix	465-474	10
α-helix	480-491	12
β-strand	499	1	9
α-helix	500-516	17
α-helix	522-536	15
β-strand	543	1	9
α-helix	544-550	7

Chain D: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	264-266	3
β-strand	269-273	5	10
α-helix	277-288	12
β-strand	292-296	5	10
α-helix	300-303	4
α-helix	304-308	5
α-helix	311	1
β-strand	312-313	2	10
α-helix	314	1
α-helix	317-323	7
β-strand	326-329	4	10
α-helix	334-342	9
α-helix	347-350	4
β-strand	356-359	4	10
α-helix	365-377	13
β-strand	381-384	4	10
β-strand	387-388	2	11
α-helix	391-396	6
β-strand	399-403	5	11
β-strand	404-405	2	10
α-helix	407-412	6
α-helix	414-420	7
β-strand	421-426	6	11
α-helix	432-460	29
α-helix	465-474	10
α-helix	480-491	12
β-strand	499	1	12
α-helix	500-516	17
α-helix	522-536	15
β-strand	543	1	12
α-helix	544-550	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-pac protein	A, B, C, D	protein	316	HOMO SAPIENS	Q49A26 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2UYY_1 N-PAC PROTEIN (chains A, B, C, D)
MHHHHHHSSGVDLGTENLYFQSMGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWN
RTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCY
VDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCF
QAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQL
ASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKAL
DQSDNDMSAVYRAYIH

Ligands and cofactors

ID	Name	Formula	Copies
NA7	[(2R,3R,4R,5R)-5-(6-amino-9H-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofu…	C15 H24 N5 O16 P3	2

Water and common crystallization additives (K) are not listed.

Primary citation

The Structure of the Cytokine-Like Nuclear Factor N-Pac. Tickle, J., Pilka, E.S., Bunkoczi, G. et al. To be published.

Other PDB entries of the same protein (UniProt Q49A26 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HSU 1.99 Å, Crystal structure of LSD2-NPAC with H3(1-26)in space group P21
4GUT 2.0 Å, Crystal structure of LSD2-NPAC
4GUS 2.23 Å, Crystal structure of LSD2-NPAC with H3 in space group P3221
4GUU 2.3 Å, Crystal structure of LSD2-NPAC with tranylcypromine
4GUR 2.51 Å, Crystal structure of LSD2-NPAC with H3 in space group P21
6R1U 4.36 Å, Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 2
6R25 4.61 Å, Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 3

Browse structure collections

About this viewer

MolViewer shows 2UYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.