2V0O: FCHO2 F-BAR domain

FCHO2 F-BAR domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Jun 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 6,757
Mol. weight: 94.76 kDa
Released: 26 Jun 2007

Explore 2V0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V0O contains 25 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	10	1	1
α-helix	17-61	45
α-helix	70-72	3
α-helix	73-118	46
α-helix	120-156	37
α-helix	160-244	85
α-helix	247-258	12
β-strand	261	1	2
α-helix	264-267	4

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	10	1	2
α-helix	17-26	10
α-helix	28-59	32
α-helix	70-72	3
α-helix	73-118	46
α-helix	121-156	36
α-helix	160-244	85
α-helix	247-258	12
β-strand	261	1	1
α-helix	264-267	4

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-9	5
α-helix	17-61	45
α-helix	70-72	3
α-helix	73-118	46
α-helix	120-155	36
α-helix	160-244	85
α-helix	247-258	12
α-helix	264-267	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fch domain only protein 2	A, B, C	protein	276	HOMO SAPIENS	Q0JRZ9 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2V0O_1 FCH DOMAIN ONLY PROTEIN 2 (chains A, B, C)
LGSPMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAK
SASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEE
VAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYK
LYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEF
INNMANTTVESLIQKFAESKGTGKERPGLIEFEECD

Primary citation

Structure and Analysis of Fcho2 F-Bar Domain: A Dimerizing and Membrane Recruitment Module that Effects Membrane Curvature. Henne, W.M., Kent, H.M., Ford, M.J.G. et al. Structure (2007) 15:839. DOI 10.1016/J.STR.2007.05.002 · PubMed

Other PDB entries of the same protein (UniProt Q0JRZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIT 1.65 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (P3221 crystal form)
7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
7OHO 2.88 Å, Crystal structure of AP2 FCHO2 chimera
7OG1 3.25 Å, AP2 clathrin adaptor core in complex with cargo peptide and FCHO2

Browse structure collections

About this viewer

MolViewer shows 2V0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.