7OIQ: AP2 Mu2

Name: PDB 7OIQ: Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
Published: 2022-06-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form). Determined by X-ray diffraction at 1.85 Å resolution. Released 1 Jun 2022.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 4
Atoms: 4,604
Mol. weight: 67.98 kDa
Released: 1 Jun 2022

Explore 7OIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OIQ contains 10 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	244-248	5	1
β-strand	253	1	2
β-strand	262-265	4	2
α-helix	267-268	2
β-strand	270-279	10	1
β-strand	287-296	10	3
β-strand	300-309	10	3
β-strand	316-325	10	1
β-strand	330-337	8	3
β-strand	341-345	5	1
α-helix	346-348	3
β-strand	350-359	10	1
β-strand	363-372	10	3
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain BBB: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	4
β-strand	191-205	15	4
β-strand	211-216	6	5
β-strand	218	1	6
β-strand	241	1	6
β-strand	245-248	4	4
β-strand	253-254	2	5
β-strand	263-265	3	5
α-helix	267-268	2
β-strand	270-279	10	4
β-strand	287-296	10	7
β-strand	300-309	10	7
β-strand	316-325	10	4
β-strand	330-337	8	7
β-strand	341-345	5	4
α-helix	346-348	3
β-strand	350-359	10	4
β-strand	363-372	10	7
α-helix	384-385	2
β-strand	386-392	7	4
β-strand	401-408	8	5
β-strand	413-414	2	5
α-helix	415-417	3
β-strand	419-433	15	4

Chains CCC and DDD: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	108-110	3
β-strand	112-113	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu	AAA, BBB	protein	285	Rattus norvegicus	P84092 (AlphaFold model)
F-BAR domain only protein 2	CCC, DDD	protein	11	Homo sapiens	Q0JRZ9 (AlphaFold model)

Sequence of entity 1 (AAA, BBB), FASTA

>7OIQ_1 AP-2 complex subunit mu (chains AAA, BBB)
MHHHHHHQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP
ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDG
EFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNT
SGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNF
EVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (CCC, DDD), FASTA

>7OIQ_2 F-BAR domain only protein 2 (chains CCC, DDD)
SDLLAWDPLFG

Primary citation

FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch. Zaccai, N.R., Kadlecova, Z., Dickson, V.K. et al. Sci Adv (2022) 8:eabn2018-eabn2018. DOI 10.1126/sciadv.abn2018 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…
1BXX 2.7 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with TGN38…

Browse structure collections

About this viewer

MolViewer shows 7OIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.