2V17: Peptide fragment

Structure of the complex of antibody MN423 with a fragment of tau protein. Determined by X-ray diffraction at 1.65 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 1.65 Å
Organisms: HOMO SAPIENS, MUS MUSCULUS
Chains: 3
Atoms: 4,069
Mol. weight: 47.91 kDa
Released: 25 Dec 2007

Explore 2V17 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V17 contains 15 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	46-51	6	3
α-helix	54-56	3
β-strand	60-62	3	3
α-helix	64-66	3
β-strand	70-75	6	1
β-strand	80-85	6	1
α-helix	90-92	3
β-strand	94-100	7	3
β-strand	111-112	2	3
β-strand	116-118	3	3
β-strand	119-120	2	2
β-strand	126	1	4
α-helix	127-128	2
β-strand	129-133	5	5
β-strand	144-154	11	5
β-strand	155	1	4
β-strand	160-164	5	6
β-strand	172-180	9	5
β-strand	183-193	11	5
β-strand	202-208	7	6
α-helix	209-211	3
β-strand	213-219	7	6

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	85-90	6	8
α-helix	96	1
β-strand	97-98	2	8
β-strand	102-106	5	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-127	6
β-strand	131-139	9	10
β-strand	140	1	9
β-strand	145-150	6	11
β-strand	153-155	3	11
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-180	8	10
α-helix	183-188	6
β-strand	191-197	7	11
α-helix	204	1
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptide fragment	A	protein	6	HOMO SAPIENS
Monoclonal antibody FAB fragment MN423	H	protein	222	MUS MUSCULUS
Monoclonal antibody FAB fragment MN423	L	protein	214	MUS MUSCULUS	P01837 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2V17_1 PEPTIDE FRAGMENT (chains A)
TDHGAE

Sequence of entity 2 (H), FASTA

>2V17_2 MONOCLONAL ANTIBODY FAB FRAGMENT MN423 (chains H)
EVNLVESGGGLEQSGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLALIRNKAKGYTT
EYSASVKGRFTISRDNSQSILYLQMNALRAEDSAIYYCARDNGAARATFAYWGQGTLVTV
SAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQ
SGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Sequence of entity 3 (L), FASTA

>2V17_3 MONOCLONAL ANTIBODY FAB FRAGMENT MN423 (chains L)
DVQITQSPSYLAASPGETITINCRASKSIRKFLAWYREKPGKTNKLLIYSGSTLQSGTPS
RFSGSGSGTDFTLTISRLEPEDFAMYYCQQHNDYPLTFGAGTKLELKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Primary citation

X-Ray Structure of the Phf Core C-Terminus: Insight Into the Folding of the Intrinsically Disordered Protein Tau in Alzheimer'S Disease. Sevcik, J., Skrabana, R., Dvorsky, R. et al. FEBS Lett (2007) 581:5872. DOI 10.1016/J.FEBSLET.2007.11.067 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 2V17 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.