2V2T: NF-kB p50-RelB-DNA complex

X-ray structure of a NF-kB p50-RelB-DNA complex. Determined by X-ray diffraction at 3.05 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 5,134
Mol. weight: 75.99 kDa
Released: 3 Jul 2007

Explore 2V2T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V2T contains 15 α-helices and 59 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	104-107	4	1
β-strand	111	1	2
α-helix	116-118	3
β-strand	119-120	2	3
α-helix	121-123	3
β-strand	132	1	2
β-strand	145-148	4	1
β-strand	156-160	5	4
β-strand	163	1	5
α-helix	170	1
β-strand	171	1	5
α-helix	172	1
β-strand	175-177	3	3
β-strand	186-190	5	4
β-strand	204-207	4	3
α-helix	213-222	10
β-strand	243-244	2	6
β-strand	245	1	5
β-strand	248	1	7
β-strand	250-254	5	4
β-strand	256-261	6	4
β-strand	265	1	7
β-strand	270-271	2	6
α-helix	276-278	3
β-strand	283	1	8
β-strand	298-302	5	9
β-strand	303	1	8
β-strand	311-316	6	10
β-strand	321-323	3	10
α-helix	324-325	2
α-helix	328-330	3
β-strand	331-332	2	9
β-strand	336-340	5	9
α-helix	341-344	4
β-strand	354	1	11
β-strand	357-361	5	10
β-strand	367	1	10
β-strand	371	1	10
β-strand	374	1	11

Chain B: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	41	1	12
β-strand	44-46	3	13
β-strand	48	1	14
β-strand	51-53	3	15
α-helix	58-60	3
β-strand	69	1	14
β-strand	73	1	16
β-strand	76	1	16
β-strand	81-83	3	13
β-strand	85	1	12
β-strand	92-98	7	15
β-strand	106	1	15
β-strand	111-112	2	17
β-strand	120-124	5	15
β-strand	131-133	3	13
β-strand	138-139	2	17
α-helix	147-158	12
α-helix	190-203	14
β-strand	209-219	11	15
β-strand	225-228	4	15
α-helix	229-231	3
β-strand	232-239	8	15
β-strand	253	1	18
β-strand	257-259	3	19
β-strand	265-269	5	18
β-strand	278-284	7	19
β-strand	292-295	4	19
β-strand	297	1	18
β-strand	303-304	2	18
β-strand	308-312	5	18
α-helix	313-315	3
α-helix	324	1
β-strand	325-333	9	19
β-strand	339	1	19
β-strand	343-348	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor relb	A	protein	288	MUS MUSCULUS	Q04863 (AlphaFold model)
Nuclear factor nf-kappa-B P105 subunit	B	protein	326	MUS MUSCULUS	P25799 (AlphaFold model)
5'-d(cpgpgpgpapaptptpcpcp*cp)-3'	C, D	DNA	11

Sequence of entity 1 (A), FASTA

>2V2T_1 TRANSCRIPTION FACTOR RELB (chains A)
LGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTQPAIELRDC
GGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRK
KEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPV
YDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQAD
VHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR

Sequence of entity 2 (B), FASTA

>2V2T_2 NUCLEAR FACTOR NF-KAPPA-B P105 SUBUNIT (chains B)
DGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQL
VTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTE
ACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAF
LPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDD
IQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDL
ETSEPKPFLYYPEIKDKEEVQRKRQK

Sequence of entity 3 (C, D), FASTA

>2V2T_3 5'-D(*CP*GP*GP*GP*AP*AP*TP*TP*CP*CP*CP)-3' (chains C, D)
CGGGAATTCCC

Primary citation

X-Ray Structure of a NF-kappaB p50/Relb/DNA Complex Reveals Assembly of Multiple Dimers on Tandem kappaB Sites. Moorthy, A.K., Huang, D.B., Wang, V.Y. et al. J Mol Biol (2007) 373:723. DOI 10.1016/J.JMB.2007.08.039 · PubMed

Other PDB entries of the same protein (UniProt Q04863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZK9 2.18 Å, NF-kB RelB forms an intertwined homodimer
1ZKA 2.2 Å, NF-kB RelB forms an intertwined homodimer, Y300S mutant
4JHB 2.44 Å, Crystal structure of RelB double mutants: Y300F/I335F
3JUZ 2.51 Å, Crystal structure of a mutant of RelB dimerization domain(M5)
3JSS 2.6 Å, Crystal structure of a mutant RelB dimerization domain
3JV0 2.65 Å, Crystal structure of a mutant of RelB dimerization domain(M6)
3JV6 2.78 Å, Crystal structure of the dimerization domains p52 and RelB
4JGM 3.0 Å, Crystal structure of RelB double mutants: Y300F/I335V
3DO7 3.05 Å, X-ray structure of a NF-kB p52/RelB/DNA complex
3JV4 3.15 Å, Crystal structure of the dimerization domains p50 and RelB

Browse structure collections

About this viewer

MolViewer shows 2V2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.