2V3S: Serine/threonine-protein kinase OSR1

Structural insights into the recognition of substrates and activators by the OSR1 kinase. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Jul 2007.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,858
Mol. weight: 22.11 kDa
Released: 3 Jul 2007

Explore 2V3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V3S contains 10 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	434-441	8	1
β-strand	447-454	8	1
α-helix	461-470	10
α-helix	476-478	3
α-helix	479-491	13
β-strand	498-502	5	1
α-helix	504-506	3
β-strand	514	1	2
α-helix	515-517	3
β-strand	519	1	2
β-strand	521-526	6	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	434-441	8	3
β-strand	447-454	8	3
α-helix	461-470	10
α-helix	476-478	3
α-helix	479-491	13
β-strand	498-502	5	3
α-helix	504-507	4
α-helix	512-513	2
β-strand	514	1	4
β-strand	519	1	4
β-strand	521-526	6	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1006-1007	2	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1006	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase OSR1	A, B	protein	96	HOMO SAPIENS	O95747 (AlphaFold model)
Serine/threonine-protein kinase WNK4	C, D	protein	6	HOMO SAPIENS	Q96J92 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2V3S_1 SERINE/THREONINE-PROTEIN KINASE OSR1 (chains A, B)
GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVE
EPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS

Sequence of entity 2 (C, D), FASTA

>2V3S_2 SERINE/THREONINE-PROTEIN KINASE WNK4 (chains C, D)
GRFQVT

Primary citation

Structural Insights Into the Recognition of Substrates and Activators by the Osr1 Kinase. Villa, F., Goebel, J., Rafiqi, F.H. et al. EMBO Rep (2007) 8:839. DOI 10.1038/SJ.EMBOR.7401048 · PubMed

Other PDB entries of the same protein (UniProt O95747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OKW 1.62 Å, 1.62A X-ray crystal structure of the conserved C-terminal (CCT) of human OSR1
2VWI 2.15 Å, Structure of the OSR1 kinase, a hypertension drug target
3DAK 2.25 Å, Crystal Structure of Domain-Swapped OSR1 kinase domain

Browse structure collections

About this viewer

MolViewer shows 2V3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.