7OKW: Serine/threonine-protein kinase OSR1

1.62A X-ray crystal structure of the conserved C-terminal (CCT) of human OSR1. Determined by X-ray diffraction at 1.62 Å resolution. Released 22 Sept 2021.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,733
Mol. weight: 22.96 kDa
Ligands: MG, CA
Released: 22 Sept 2021

Explore 7OKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OKW contains 11 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	432-433	2
β-strand	434-441	8	1
β-strand	447-454	8	1
α-helix	461-470	10
α-helix	476-478	3
α-helix	479-491	13
β-strand	496-502	7	1
β-strand	514	1	2
β-strand	519	1	2
β-strand	521-526	6	1

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	432-433	2
β-strand	434-441	8	1
β-strand	447-454	8	1
α-helix	461-470	10
α-helix	476-478	3
α-helix	479-491	13
β-strand	496-502	7	1
α-helix	504-507	4
α-helix	512-513	2
β-strand	514	1	3
α-helix	515-517	3
β-strand	519	1	3
β-strand	521-526	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase OSR1	A, B	protein	106	Homo sapiens	O95747 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7OKW_1 Serine/threonine-protein kinase OSR1 (chains A, B)
GSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVI
VAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
CA	Calcium ion	Ca	1

Water and common crystallization additives (NA, MPD) are not listed.

Primary citation

Structures of the Human SPAK and OSR1 Conserved C-Terminal (CCT) Domains. Elvers, K.T., Lipka-Lloyd, M., Trueman, R.C. et al. Chembiochem (2022) 23:e202100441-e202100441. DOI 10.1002/cbic.202100441 · PubMed

Other PDB entries of the same protein (UniProt O95747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V3S 1.7 Å, Structural insights into the recognition of substrates and activators by the OSR1 kinase
2VWI 2.15 Å, Structure of the OSR1 kinase, a hypertension drug target
3DAK 2.25 Å, Crystal Structure of Domain-Swapped OSR1 kinase domain

Browse structure collections

About this viewer

MolViewer shows 7OKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.