2V5N: Human IGF2R domains 11-12

Structure of human IGF2R domains 11-12. Determined by X-ray diffraction at 3.2 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,045
Mol. weight: 33.42 kDa
Ligands: NAG
Released: 11 Dec 2007

Explore 2V5N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V5N contains 6 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1520	4	1
β-strand	1525-1528	4	1
α-helix	1530-1532	3
β-strand	1538-1541	4	2
β-strand	1547-1550	4	2
β-strand	1563	1	3
β-strand	1565-1567	3	2
β-strand	1572-1573	2	2
β-strand	1576	1	3
β-strand	1582-1583	2	4
β-strand	1587-1592	6	4
β-strand	1593	1	3
β-strand	1597	1	5
β-strand	1605	1	5
β-strand	1607-1614	8	4
β-strand	1625-1630	6	4
β-strand	1635-1642	8	4
α-helix	1643-1645	3
β-strand	1653-1656	4	6
β-strand	1659-1662	4	6
α-helix	1664-1666	3
β-strand	1673	1	7
β-strand	1689-1692	4	7
α-helix	1697-1700	4
β-strand	1701	1	8
β-strand	1704	1	8
α-helix	1706-1707	2
β-strand	1712-1715	4	7
β-strand	1722-1723	2	7
β-strand	1726-1727	2	9
β-strand	1732-1734	3	9
β-strand	1739-1749	11	9
α-helix	1750	1
β-strand	1757-1766	10	9
β-strand	1776-1780	5	9
β-strand	1784-1791	8	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A	protein	299	Homo sapiens	P11717 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2V5N_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains A)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESEDDASDTN
PDFYINICQPLNPMHAVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESS
TPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structure and Functional Analysis of the Igf-II/Igf2R Interaction. Brown, J., Delaine, C., Zaccheo, O.J. et al. EMBO J (2008) 27:265. DOI 10.1038/SJ.EMBOJ.7601938 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR

Browse structure collections

About this viewer

MolViewer shows 2V5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.