2VER: Afimbrial adhesin afa-III

Structural model for the complex between the Dr adhesins and carcinoembryonic antigen (CEA). Determined by solution NMR. Released 8 Jan 2008.

Method: Solution NMR
Organisms: ESCHERICHIA COLI, HOMO SAPIENS
Chains: 2
Atoms: 1,993
Mol. weight: 28.56 kDa
Ligands: MTN
Released: 8 Jan 2008

Explore 2VER in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VER contains 3 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	7-9	3
β-strand	10-13	4	2
β-strand	28-31	4	3
β-strand	32-33	2	1
β-strand	39-44	6	2
β-strand	49-50	2	4
β-strand	53-54	2	4
β-strand	55-57	3	2
β-strand	64-66	3	2
β-strand	67-71	5	3
β-strand	78	1	2
β-strand	83-85	3	2
β-strand	93-100	8	3
β-strand	111-122	12	2
β-strand	128-130	3	2
β-strand	133-134	2	1
β-strand	135-141	7	2

Chain N: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	5
β-strand	10-12	3	6
β-strand	17-22	6	5
β-strand	28-34	7	7
β-strand	44-49	6	7
α-helix	50-52	3
β-strand	54-57	4	7
β-strand	65-67	3	5
β-strand	73-75	3	5
α-helix	80-82	3
β-strand	84-92	9	7
β-strand	99-104	6	7
β-strand	105-107	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afimbrial adhesin afa-III	A	protein	143	ESCHERICHIA COLI	Q57254 (AlphaFold model)
Arcinoembryonic antigen-related cell adhesion molecule 5	N	protein	110	HOMO SAPIENS	P06731 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VER_1 AFIMBRIAL ADHESIN AFA-III (chains A)
EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDN
NRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGY
WAKDNKQGFTPSGTTGTTKLTVT

Sequence of entity 2 (N), FASTA

>2VER_2 ARCINOEMBRYONIC ANTIGEN-RELATED CELL ADHESION MOLECULE 5 (chains N)
KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERCDGNCQIIGYVIGTQCATPGPA
YSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPEL

Ligands and cofactors

ID	Name	Formula	Copies
MTN	S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl]…	C10 H18 N O3 S2	3

Primary citation

Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation. Korotkova, N., Yang, Y., Le Trong, I. et al. Mol Microbiol (2008) 67:420. DOI 10.1111/J.1365-2958.2007.06054.X · PubMed

Other PDB entries of the same protein (UniProt Q57254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1USZ 3.28 Å, SeMet AfaE-3 adhesin from Escherichia Coli
1UT2 3.3 Å, AfaE-3 adhesin from Escherichia Coli
1RXL Solution structure of the engineered protein Afae-dsc
2IXQ The solution structure of the invasive tip complex from Afa-Dr fibrils

Browse structure collections

About this viewer

MolViewer shows 2VER directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.