2VLW: Muscarinic toxin MT7 diiodoTYR51 derivative

Name: PDB 2VLW: Crystal structure of the muscarinic toxin MT7 diiodoTYR51 derivative.
Published: 2008-10-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of the muscarinic toxin MT7 diiodoTYR51 derivative. Determined by X-ray diffraction at 1.39 Å resolution. Released 14 Oct 2008.

Method: X-ray diffraction
Resolution: 1.39 Å
Organism: DENDROASPIS ANGUSTICEPS
Chains: 2
Atoms: 1,229
Mol. weight: 15.73 kDa
Released: 14 Oct 2008

Explore 2VLW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VLW contains 4 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	6	1	2
β-strand	13-16	4	1
α-helix	17-18	2
β-strand	23-32	10	2
β-strand	35-43	9	2
α-helix	47-49	3
β-strand	50	1	2
β-strand	53-58	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic M1-TOXIN1	A, B	protein	65	DENDROASPIS ANGUSTICEPS	Q8QGR0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VLW_1 MUSCARINIC M1-TOXIN1 (chains A, B)
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGT
DKCNK

Primary citation

Different Interactions between Mt7 Toxin and the Human Muscarinic M1 Receptor in its Free and N-Methylscopolamine-Occupied States. Fruchart-Gaillard, C., Mourier, G., Marquer, C. et al. Mol Pharmacol (2008) 74:1554. DOI 10.1124/MOL.108.050773 · PubMed

Other PDB entries of the same protein (UniProt Q8QGR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NEQ 1.25 Å, Crystal structure of the chimeric muscarinic toxin MT7 with loop 3 from MT1
3FEV 1.3 Å, Crystal structure of the chimeric muscarinic toxin MT7 with loop 1 from MT1.
6WJC 2.55 Å, Muscarinic acetylcholine receptor 1 - muscarinic toxin 7 complex

Browse structure collections

About this viewer

MolViewer shows 2VLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.