Structure of mouse A1 bound to the Bak BH3-domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 4 Mar 2008.
Explore 2VOH in 3D Show helices and sheets RCSB PDB PDBe
2VOH contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-21 | 22 | |
| α-helix | 32-51 | 20 | |
| α-helix | 53-56 | 4 | |
| α-helix | 64-78 | 15 | |
| α-helix | 86-107 | 22 | |
| α-helix | 112-136 | 25 | |
| α-helix | 139-144 | 6 | |
| α-helix | 145-148 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 67-85 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bcl-2-related protein A1 | A | protein | 157 | MUS MUSCULUS | Q07440 (AlphaFold model) |
| Bcl-2 homologous antagonist/killer | B | protein | 26 | MUS MUSCULUS | O08734 (AlphaFold model) |
>2VOH_1 BCL-2-RELATED PROTEIN A1 (chains A) GPLGSMAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSY LDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLKQEQIALDVSAY KQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKS
>2VOH_2 BCL-2 HOMOLOGOUS ANTAGONIST/KILLER (chains B) PNSILGQVGRQLALIGDDINRRYDTE
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 1 |
Water and common crystallization additives (SO4) are not listed.
Structural Plasticity Underpins Promiscuous Binding of the Prosurvival Protein A1. Smits, C., Czabotar, P.E., Hinds, M.G. et al. Structure (2008) 16:818. DOI 10.1016/J.STR.2008.02.009 · PubMed
Other PDB entries of the same protein (UniProt Q07440 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VOH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.