2VPV: Dimerization Domain of Mif2p

Dimerization Domain of Mif2p. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Aug 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 1,519
Mol. weight: 37.54 kDa
Released: 26 Aug 2008

Explore 2VPV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VPV contains 3 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	438	1	1
β-strand	443-444	2	2
β-strand	453-459	7	2
α-helix	463-465	3
β-strand	467-470	4	1
β-strand	474-482	9	2
β-strand	484-489	6	1
β-strand	492-497	6	1
β-strand	501-504	4	2
β-strand	509-514	6	1
α-helix	519	1
β-strand	520-528	9	2

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	440-444	5	3
β-strand	453-459	7	3
β-strand	466-468	3	4
β-strand	474-482	9	3
β-strand	484-489	6	4
β-strand	492-497	6	4
β-strand	501-504	4	3
β-strand	510-514	5	4
α-helix	519	1
β-strand	520-528	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein MIF2	A, B	protein	166	SACCHAROMYCES CEREVISIAE	P35201 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VPV_1 PROTEIN MIF2 (chains A, B)
DPNAKENLIPEDPNEDIIERIESGGIENGEWLKHGILEANVKISDTKEETKDEIIAFAPN
LSQTEQVKDTKDENFALEIMFDKHKEYFASGILKLPAISGQKKLSNSFRTYITFHVIQGI
VEVTVCKNKFLSVKGSTFQIPAFNEYAIANRGNDEAKMFFVQVTVS

Primary citation

Structural and Functional Dissection of Mif2P, a Conserved DNA-Binding Kinetochore Protein. Cohen, R.L., Espelin, C.W., De Wulf, P. et al. Mol Biol Cell (2008) 19:4480. DOI 10.1091/MBC.E08-03-0297 · PubMed

Other PDB entries of the same protein (UniProt P35201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ON1 3.35 Å, Cenp-A nucleosome in complex with Cenp-C
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex

Browse structure collections

About this viewer

MolViewer shows 2VPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.