2VSW: Dual specificity protein phosphatase 16

The structure of the rhodanese domain of the human dual specificity phosphatase 16. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Jul 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,123
Mol. weight: 34.15 kDa
Released: 15 Jul 2008

Explore 2VSW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VSW contains 18 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
α-helix	12-19	8
β-strand	26-30	5	1
α-helix	34-39	6
β-strand	41-42	2	2
α-helix	45	1
β-strand	46-47	2	1
α-helix	52-59	8
α-helix	65-71	7
α-helix	77-79	3
β-strand	84-88	5	1
α-helix	95-97	3
α-helix	103-114	12
β-strand	118-121	4	1
α-helix	124-131	8
α-helix	133-135	3
β-strand	136-137	2	2

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	3
α-helix	12-20	9
β-strand	26-30	5	3
α-helix	34-39	6
β-strand	41-42	2	4
α-helix	45	1
β-strand	46-47	2	3
α-helix	52-59	8
α-helix	65-71	7
β-strand	84-88	5	3
α-helix	103-114	12
β-strand	117-122	6	3
α-helix	124-129	6
α-helix	133-135	3
β-strand	136-137	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity protein phosphatase 16	A, B	protein	153	HOMO SAPIENS	Q9BY84 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VSW_1 DUAL SPECIFICITY PROTEIN PHOSPHATASE 16 (chains A, B)
MIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVL
ITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGG
FAEFSRCFPGLCEGKSTLVPTCISQPAHHHHHH

Primary citation

The Structure of the Rhodanese Domain of the Human Dual Specifity Phosphatase 16. Murray, J.W., Barr, A., Pike, A.C.W. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BY84 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YR8 2.4 Å, Crystal structure of JNK in complex with a regulator protein
3TG3 2.67 Å, Crystal structure of the MAPK binding domain of MKP7

Browse structure collections

About this viewer

MolViewer shows 2VSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.