3TG3: MAPK binding domain of MKP7

Crystal structure of the MAPK binding domain of MKP7. Determined by X-ray diffraction at 2.67 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 2.67 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,042
Mol. weight: 64.08 kDa
Released: 14 Mar 2012

Explore 3TG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TG3 contains 28 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
α-helix	12-20	9
β-strand	26-30	5	1
α-helix	34-39	6
β-strand	41-42	2	2
β-strand	46-47	2	1
α-helix	52-60	9
α-helix	65-72	8
β-strand	84-88	5	1
α-helix	103-112	10
β-strand	118-121	4	1
α-helix	124-131	8
α-helix	133-135	3
β-strand	136-137	2	2

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	3
α-helix	12-20	9
β-strand	26-30	5	3
α-helix	34-39	6
β-strand	41-42	2	4
β-strand	46-47	2	3
α-helix	52-60	9
α-helix	65-72	8
β-strand	84-88	5	3
α-helix	103-112	10
β-strand	118-122	5	3
α-helix	124-129	6
α-helix	133-135	3
β-strand	136-137	2	4

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	7
α-helix	12-20	9
β-strand	26-30	5	7
α-helix	34-39	6
β-strand	41-42	2	8
β-strand	46-47	2	7
α-helix	52-60	9
α-helix	65-70	6
β-strand	84-88	5	7
α-helix	103-112	10
β-strand	118-121	4	7
α-helix	124-131	8
α-helix	133-135	3
β-strand	136-137	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity protein phosphatase 16	A, B, C, D	protein	142	Homo sapiens	Q9BY84 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3TG3_1 Dual specificity protein phosphatase 16 (chains A, B, C, D)
MIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVL
ITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGG
FAEFSRCFPGLCEGLEHHHHHH

Primary citation

A Distinct Interaction Mode Revealed by the Crystal Structure of the Kinase p38alpha with the MAPK Binding Domain of the Phosphatase MKP5. Zhang, Y.Y., Wu, J.W., Wang, Z.X. Sci Signal (2011) 4:ra88-ra88. DOI 10.1126/scisignal.2002241 · PubMed

Other PDB entries of the same protein (UniProt Q9BY84 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VSW 2.2 Å, The structure of the rhodanese domain of the human dual specificity phosphatase 16
4YR8 2.4 Å, Crystal structure of JNK in complex with a regulator protein

Browse structure collections

About this viewer

MolViewer shows 3TG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.