ephB4 kinase domain inhibitor complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Jul 2008.
Explore 2VWU in 3D Show helices and sheets RCSB PDB PDBe
2VWU contains 17 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 612-614 | 3 | |
| β-strand | 615-623 | 9 | 1 |
| β-strand | 628-634 | 7 | 1 |
| β-strand | 642-648 | 7 | 1 |
| α-helix | 656-668 | 13 | |
| β-strand | 676 | 1 | 2 |
| α-helix | 677-678 | 2 | |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 690-694 | 5 | 1 |
| β-strand | 699-700 | 2 | 2 |
| α-helix | 701-707 | 7 | |
| α-helix | 714-733 | 20 | |
| α-helix | 743-745 | 3 | |
| β-strand | 746-748 | 3 | 2 |
| β-strand | 754-756 | 3 | 2 |
| α-helix | 784-786 | 3 | |
| α-helix | 789-794 | 6 | |
| α-helix | 799-814 | 16 | |
| α-helix | 818-819 | 2 | |
| α-helix | 826-834 | 9 | |
| α-helix | 839-842 | 4 | |
| α-helix | 847-856 | 10 | |
| α-helix | 861-863 | 3 | |
| α-helix | 865-866 | 2 | |
| α-helix | 867-879 | 13 | |
| α-helix | 881-885 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ephrin type-B receptor 4 | A | protein | 302 | HOMO SAPIENS | P54760 (AlphaFold model) |
>2VWU_1 EPHRIN TYPE-B RECEPTOR 4 (chains A) DPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQ RREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQL VGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTETSS LGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDY RLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHP LL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7X1 | N-(5-chloro-1,3-benzodioxol-4-yl)-6-methoxy-7-(3-piperidin-1-ylpropoxy)quinazol… | C24 H27 Cl N4 O4 | 1 |
Inhibitors of the Tyrosine Kinase Ephb4. Part 1: Structure-Based Design and Optimization of a Series of 2,4-Bis-Anilinopyrimidines. Bardelle, C., Cross, D., Davenport, S. et al. Bioorg Med Chem Lett (2008) 18:2776. DOI 10.1016/J.BMCL.2008.04.015 · PubMed
Other PDB entries of the same protein (UniProt P54760 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.