2VWV: EphB4 kinase domain inhibitor complex

ephB4 kinase domain inhibitor complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Jul 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,127
Mol. weight: 34.35 kDa
Ligands: 7X3
Released: 8 Jul 2008

Explore 2VWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VWV contains 17 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	609	1	1
α-helix	612-614	3
β-strand	615-623	9	1
β-strand	628-634	7	1
α-helix	640-641	2
β-strand	642-648	7	1
α-helix	655-668	14
β-strand	676	1	2
β-strand	679-683	5	1
β-strand	690-694	5	1
β-strand	700	1	2
α-helix	701-707	7
α-helix	714-733	20
α-helix	743-745	3
β-strand	746-748	3	2
β-strand	754-756	3	2
α-helix	784-786	3
α-helix	789-794	6
α-helix	799-814	16
α-helix	818-819	2
α-helix	826-834	9
α-helix	839-842	4
α-helix	847-856	10
α-helix	861-863	3
α-helix	865-866	2
α-helix	867-879	13
α-helix	881-884	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-B receptor 4	A	protein	302	HOMO SAPIENS	P54760 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VWV_1 EPHRIN TYPE-B RECEPTOR 4 (chains A)
DPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQ
RREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQL
VGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTETSS
LGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDY
RLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHP
LL

Ligands and cofactors

ID	Name	Formula	Copies
7X3	N'-(3-chloro-4-methoxy-phenyl)-N-(3,4,5-trimethoxyphenyl)-1,3,5-triazine-2,4-di…	C19 H20 Cl N5 O4	1

Primary citation

Inhibitors of the Tyrosine Kinase Ephb4. Part 1: Structure-Based Design and Optimization of a Series of 2,4-Bis-Anilinopyrimidines. Bardelle, C., Cross, D., Davenport, S. et al. Bioorg Med Chem Lett (2008) 18:2776. DOI 10.1016/J.BMCL.2008.04.015 · PubMed

Other PDB entries of the same protein (UniProt P54760 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FNK 1.05 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with a…
6FNM 1.16 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with Dasatinib
6FNJ 1.24 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with an isomer of…
6FNL 1.27 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase
6FNI 1.47 Å, Crystal Structure of Ephrin B4 (EphB4) Receptor Protein Kinase with NVP-BHG712
2BBA 1.65 Å, Crystal Structure and Thermodynamic Characterization of the EphB4 Receptor in Complex…
2VWX 1.65 Å, ephB4 kinase domain inhibitor complex
2VWY 1.65 Å, ephB4 kinase domain inhibitor complex
2VWZ 1.65 Å, ephB4 kinase domain inhibitor complex
2VX1 1.65 Å, ephB4 kinase domain inhibitor complex
4BB4 1.65 Å, ephB4 kinase domain inhibitor complex
2XVD 1.7 Å, ephB4 kinase domain inhibitor complex

Browse structure collections

About this viewer

MolViewer shows 2VWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.