2W0G: HSP90 co-chaperone CDC37

Name: PDB 2W0G: HSP90 co-chaperone CDC37
Published: 2008-12-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

HSP90 co-chaperone CDC37. Determined by X-ray diffraction at 1.88 Å resolution. Released 9 Dec 2008.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,180
Mol. weight: 15.52 kDa
Released: 9 Dec 2008

Explore 2W0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W0G contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	149-163	15
α-helix	168-177	10
α-helix	179-181	3
α-helix	184-199	16
α-helix	203-226	24
α-helix	230-241	12
α-helix	247-272	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HSP90 co-chaperone CDC37	A	protein	129	HOMO SAPIENS	Q16543 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W0G_1 HSP90 CO-CHAPERONE CDC37 (chains A)
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALME
QVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRA
KLRIEKAMK

Primary citation

The Human Cdc37.Hsp90 Complex Studied by Heteronuclear NMR Spectroscopy. Sreeramulu, S., Jonker, H.R.A., Richter, C. et al. J Biol Chem (2009) 284:3885. DOI 10.1074/JBC.M806715200 · PubMed

Other PDB entries of the same protein (UniProt Q16543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HPE 2.27 Å, Phosphatase domain of PP5 bound to a phosphomimetic Cdc37 substrate peptide
1US7 2.3 Å, Complex of Hsp90 and P50
9KQN 2.84 Å, Hsp90-Cdc37-PINK1 complex
7Z38 3.16 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-I)
8GAE 3.3 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
7ZR0 3.4 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E) complex.
7Z37 3.67 Å, Structure of the RAF1-HSP90-CDC37 complex (RHC-II)
8U1L 3.7 Å, Cryo-EM structure of the RAF1-HSP90-CDC37 complex in the closed state
8GFT 3.8 Å, Hsp90 provides platform for CRaf dephosphorylation by PP5
5FWK 3.9 Å, Atomic cryoEM structure of Hsp90-Cdc37-Cdk4 complex
7ZR5 3.9 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E)-PP5(closed) complex
7ZR6 4.2 Å, CryoEM structure of HSP90-CDC37-BRAF(V600E)-PP5(open) complex

Browse structure collections

About this viewer

MolViewer shows 2W0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.