2W1O: 60S acidic ribosomal protein P2

NMR structure of dimerization domain of human ribosomal protein P2. Determined by solution NMR. Released 17 Nov 2009.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,010
Mol. weight: 14.41 kDa
Released: 17 Nov 2009

Explore 2W1O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W1O contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-12	11
α-helix	20-30	11
α-helix	37-48	12
α-helix	51-58	8
α-helix	60-62	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
60S acidic ribosomal protein P2	A, B	protein	70	HOMO SAPIENS	P05387 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2W1O_1 60S ACIDIC RIBOSOMAL PROTEIN P2 (chains A, B)
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGI
GKLASVPAGG

Primary citation

Solution Structure of the Dimerization Domain of Ribosomal Protein P2 Provides Insights for the Structural Organization of Eukaryotic Stalk. Lee, K.M., Yu, C.W., Chan, D.S. et al. Nucleic Acids Res (2010) 38:5206. DOI 10.1093/NAR/GKQ231 · PubMed

Other PDB entries of the same protein (UniProt P05387 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DDZ 1.5 Å, Crystal structure of the RTA-c10-P2 complex
5GU4 1.55 Å, rRNA N-glycosylase RTA
2JDL 2.2 Å, Structure of C-terminal region of acidic P2 ribosomal protein complexed with trichosanthin
4V6X 5.0 Å, Structure of the human 80S ribosome
1S4J NMR structure of cross-reactive peptides from Homo sapiens
2LBF Solution structure of the dimerization domain of human ribosomal protein P1/P2 heterodimer
4BEH Solution structure of human ribosomal protein P1.P2 heterodimer

Browse structure collections

About this viewer

MolViewer shows 2W1O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.