5GU4: RRNA N-glycosylase RTA

rRNA N-glycosylase RTA. Determined by X-ray diffraction at 1.55 Å resolution. Released 2 Nov 2016.

Method: X-ray diffraction
Resolution: 1.55 Å
Organisms: Ricinus communis, Homo sapiens
Chains: 4
Atoms: 4,333
Mol. weight: 69.1 kDa
Released: 2 Nov 2016

Explore 5GU4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GU4 contains 31 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	18-32	15
β-strand	38-39	2	2
β-strand	42-43	2	2
β-strand	44	1	3
α-helix	45-47	3
α-helix	53-55	3
β-strand	57-63	7	1
β-strand	69-75	7	1
β-strand	81-86	6	1
β-strand	89-92	4	1
α-helix	93-95	3
α-helix	98-103	6
α-helix	104-106	3
β-strand	113-116	4	1
α-helix	123-130	8
α-helix	134-136	3
β-strand	139	1	4
α-helix	141-154	14
α-helix	161-171	11
α-helix	172-177	6
α-helix	178-180	3
α-helix	182-193	12
β-strand	198	1	4
α-helix	202-219	18
β-strand	222	1	5
β-strand	225-233	9	5
β-strand	239-244	6	5
α-helix	245-248	4
β-strand	255	1	3

Chain B: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	6
α-helix	18-32	15
β-strand	38-39	2	7
β-strand	42-43	2	7
β-strand	44	1	8
α-helix	45-47	3
α-helix	53-55	3
β-strand	57-63	7	6
β-strand	69-75	7	6
β-strand	81-86	6	6
β-strand	89-92	4	6
α-helix	98-104	7
β-strand	113-116	4	6
α-helix	123-130	8
α-helix	134-136	3
β-strand	139	1	9
α-helix	141-154	14
α-helix	161-171	11
α-helix	172-177	6
α-helix	178-180	3
α-helix	182-193	12
β-strand	198	1	9
α-helix	199-201	3
α-helix	202-219	18
β-strand	222	1	10
β-strand	225-233	9	10
β-strand	239-244	6	10
α-helix	246-248	3
β-strand	255	1	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ricin	A, B	protein	301	Ricinus communis	P02879 (AlphaFold model)
Gly-phe-gly-leu-phe-asp	C, D	protein	9	Homo sapiens	P05387 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5GU4_1 Ricin (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSIFPKQYPIINFTTAGATVQSYTNFIR
AVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRA
GNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEE
AISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVIT
LENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQ
F

Sequence of entity 2 (C, D), FASTA

>5GU4_2 GLY-PHE-GLY-LEU-PHE-ASP (chains C, D)
DDMGFGLFD

Primary citation

Crystal Structure of Ribosome-Inactivating Protein Ricin A Chain in Complex with the C-Terminal Peptide of the Ribosomal Stalk Protein P2. Shi, W.W., Tang, Y.S., Sze, S.Y. et al. Toxins (Basel) (2016) 8. DOI 10.3390/toxins8100296 · PubMed

Other PDB entries of the same protein (UniProt P02879 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Y07 1.25 Å, Crystal structure of Ricin A chain bound with (S)-2-amino-N-(1-hydroxy-3-phenylpropan-2-y…
7Y08 1.25 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
3PX8 1.29 Å, RTA in complex with 7-carboxy-pterin
7XZT 1.3 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7TGF 1.35 Å, Single-domain VHH intrabodies neutralize ricin toxin.
7Y03 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
7Y06 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
2VC4 1.39 Å, Ricin A-Chain (Recombinant) E177D Mutant
1UQ5 1.4 Å, Ricin a-chain (recombinant) N122A mutant
7XZW 1.45 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7Y4M 1.45 Å, Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-ca…
1J1M 1.5 Å, Ricin A-Chain (Recombinant) at 100K

Browse structure collections

About this viewer

MolViewer shows 5GU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.