2W4R: Regulatory domain of human LGP2

Crystal structure of the regulatory domain of human LGP2. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Feb 2009.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 4,191
Mol. weight: 66.14 kDa
Ligands: HG
Released: 24 Feb 2009

Explore 2W4R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W4R contains 32 α-helices and 46 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3
β-strand	553-556	4	1
β-strand	562-565	4	1
α-helix	566-568	3
β-strand	569-572	4	2
β-strand	576-579	4	2
α-helix	582-586	5
β-strand	588-591	4	2
β-strand	592	1	3
β-strand	605-612	8	2
β-strand	618-625	8	2
β-strand	628-633	6	2
α-helix	634	1
α-helix	635-637	3
β-strand	638-642	5	1
β-strand	645-647	3	1
α-helix	652-654	3
α-helix	660	1
β-strand	661	1	2
α-helix	662	1
α-helix	664-667	4

Chain B: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3
β-strand	553-556	4	4
β-strand	562-565	4	4
α-helix	566-568	3
β-strand	569-572	4	5
β-strand	576-579	4	5
α-helix	582-587	6
β-strand	588-591	4	5
β-strand	605-612	8	5
β-strand	617	1	3
β-strand	618-625	8	5
β-strand	628-633	6	5
α-helix	634	1
α-helix	635-637	3
β-strand	638-642	5	4
β-strand	645-647	3	4
α-helix	652-654	3
α-helix	660	1
β-strand	661	1	5
α-helix	662	1
α-helix	664-675	12

Chain C: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	544-548	5
α-helix	549-551	3
β-strand	553-556	4	6
β-strand	562-565	4	6
α-helix	566-568	3
β-strand	569-572	4	7
β-strand	576-579	4	7
α-helix	582-587	6
β-strand	588-590	3	7
β-strand	605-612	8	7
β-strand	618-625	8	7
β-strand	628-633	6	7
α-helix	635-637	3
β-strand	638-642	5	6
β-strand	645-647	3	6
α-helix	652-654	3
β-strand	661	1	7
α-helix	664-670	7

Chain D: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	546-548	3
α-helix	549-551	3
β-strand	553-556	4	8
β-strand	562-565	4	8
α-helix	566-568	3
β-strand	569-572	4	9
β-strand	576-579	4	9
α-helix	582-587	6
β-strand	588-591	4	9
β-strand	605-612	8	9
β-strand	618-625	8	9
β-strand	628-633	6	9
α-helix	635-637	3
β-strand	638-641	4	8
β-strand	646-647	2	8
α-helix	652-654	3
β-strand	661	1	9
α-helix	664-672	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable ATP-dependent RNA helicase DHX58	A, B, C, D	protein	142	HOMO SAPIENS	Q96C10 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2W4R_1 PROBABLE ATP-DEPENDENT RNA HELICASE DHX58 (chains A, B, C, D)
AAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVV
INKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVP
FSVPDFDFLQHCAENLSDLSLD

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

The Regulatory Domain of the Rig-I Family ATPase Lgp2 Senses Double-Stranded RNA. Pippig, D.A., Hellmuth, J.C., Cui, S. et al. Nucleic Acids Res (2009) 37:2014. DOI 10.1093/NAR/GKP059 · PubMed

Other PDB entries of the same protein (UniProt Q96C10 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EQT 2.0 Å, Crystal structure of human LGP2 C-terminal domain in complex with dsRNA
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9LOU 3.36 Å, LGP2:dsRNA complex
2RQA Solution structure of LGP2 CTD

Browse structure collections

About this viewer

MolViewer shows 2W4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.