9LOV: LGP2:MDA5:dsRNA filament

LGP2:MDA5:dsRNA filament. Determined by electron microscopy at 3.07 Å resolution. Released 28 Jan 2026.

Method: Electron microscopy
Resolution: 3.07 Å
Organisms: uncultured archaeon, Homo sapiens
Chains: 5
Atoms: 17,978
Mol. weight: 277.1 kDa
Ligands: ADP, ZN, MG
Released: 28 Jan 2026

Explore 9LOV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LOV contains 105 α-helices and 76 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
α-helix	12-15	4
β-strand	20-23	4	1
α-helix	30-44	15
β-strand	50-54	5	1
α-helix	57-70	14
β-strand	77-80	4	1
α-helix	90-96	7
β-strand	99-103	5	1
α-helix	104-111	8
β-strand	127-131	5	1
α-helix	133-135	3
α-helix	141-154	14
α-helix	159-161	3
β-strand	162-167	6	1
α-helix	178-192	15
β-strand	196-198	3	1
β-strand	215-218	4	2
β-strand	221	1	3
α-helix	222-224	3
α-helix	228-244	17
α-helix	256-272	17
α-helix	275-296	22
α-helix	299-316	18
α-helix	322-333	12
α-helix	335-344	10
α-helix	346-348	3
α-helix	349-363	15
β-strand	370-373	4	2
α-helix	377-388	12
α-helix	391-395	5
β-strand	400-403	4	2
α-helix	417-429	13
β-strand	434-437	4	2
α-helix	439-442	4
β-strand	452-456	5	2
α-helix	462-471	10
β-strand	478-482	5	2
β-strand	484	1	3
α-helix	488-512	25
α-helix	515-539	25
β-strand	553-556	4	4
β-strand	562-565	4	4
α-helix	566-568	3
β-strand	569-572	4	5
β-strand	576-579	4	5
α-helix	584-587	4
β-strand	588-591	4	5
α-helix	608	1
β-strand	609-612	4	5
β-strand	618-625	8	5
β-strand	628-633	6	5
β-strand	638-641	4	4
β-strand	646-647	2	4
α-helix	652-654	3
α-helix	659-660	2
β-strand	661	1	5
α-helix	664-668	5

Chain B: 39 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	310-320	11
β-strand	325-328	4	6
α-helix	329-330	2
α-helix	335-352	18
β-strand	359-363	5	6
α-helix	366-371	6
α-helix	372-377	6
α-helix	378-381	4
β-strand	387-390	4	6
α-helix	395-399	5
α-helix	400-406	7
β-strand	409-413	5	6
α-helix	414-422	9
α-helix	434-436	3
β-strand	439-442	4	6
α-helix	453-473	21
α-helix	477-480	4
α-helix	482	1
β-strand	483-488	6	6
α-helix	499-512	14
β-strand	517-519	3	6
α-helix	525-531	7
α-helix	535	1
β-strand	536-542	7	7
α-helix	549-565	17
α-helix	572	1
α-helix	576-592	17
α-helix	595-616	22
α-helix	619-637	19
α-helix	671-682	12
α-helix	684-691	8
α-helix	699-714	16
β-strand	721-724	4	7
α-helix	728-740	13
α-helix	742-746	5
β-strand	751-754	4	7
α-helix	768-779	12
β-strand	785-788	4	7
α-helix	790-793	4
β-strand	803-807	5	7
α-helix	813-821	9
β-strand	829-835	7	7
α-helix	840-862	23
α-helix	866-890	25
α-helix	900-902	3
β-strand	903-907	5	8
β-strand	913-916	4	8
α-helix	917-919	3
β-strand	920-923	4	9
β-strand	927-930	4	9
α-helix	933-936	4
β-strand	939-941	3	10
α-helix	945-950	6
α-helix	958	1
β-strand	959-962	4	10
β-strand	967-970	4	10
β-strand	971-974	4	11
β-strand	977-980	4	11
β-strand	981	1	9
α-helix	984-986	3
β-strand	987-991	5	8
β-strand	997-998	2	8
α-helix	1010-1011	2
β-strand	1012	1	9
α-helix	1013	1

Chain C: 34 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	310-320	11
β-strand	325-328	4	12
α-helix	335-350	16
β-strand	359-363	5	12
α-helix	366-372	7
α-helix	373-377	5
α-helix	378-381	4
β-strand	387-390	4	12
α-helix	395-397	3
α-helix	400-406	7
β-strand	409-413	5	12
α-helix	414-420	7
α-helix	434-436	3
β-strand	439-442	4	12
α-helix	445-447	3
α-helix	453-473	21
α-helix	482	1
β-strand	483-488	6	12
α-helix	499-513	15
β-strand	517-519	3	12
α-helix	525-531	7
β-strand	536-542	7	13
α-helix	549-564	16
α-helix	576-592	17
α-helix	595-616	22
α-helix	619-636	18
α-helix	671-681	11
α-helix	684-692	9
α-helix	699-714	16
β-strand	721-724	4	13
α-helix	728-740	13
α-helix	742-746	5
β-strand	751-754	4	13
α-helix	764-765	2
α-helix	768-780	13
β-strand	785-788	4	13
α-helix	790-793	4
α-helix	799-801	3
β-strand	803-807	5	13
α-helix	813-822	10
β-strand	829-835	7	13
α-helix	840-862	23
α-helix	866-890	25
β-strand	903-907	5	14
β-strand	913-916	4	14
α-helix	917-919	3
β-strand	920-923	4	15
β-strand	927-930	4	15
α-helix	933-938	6
β-strand	940-941	2	15
β-strand	959-961	3	15
β-strand	967-974	8	15
β-strand	977-982	6	15
β-strand	987-991	5	14
β-strand	997-998	2	14
α-helix	1003-1005	3
α-helix	1010-1011	2
β-strand	1012	1	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (45-mer)	Y	RNA	45	uncultured archaeon
RNA (45-mer)	X	RNA	45	uncultured archaeon
ATP-dependent RNA helicase DHX58	A	protein	678	Homo sapiens	Q96C10 (AlphaFold model)
Interferon-induced helicase C domain-containing protein 1	B, C	protein	739	Homo sapiens	Q9BYX4 (AlphaFold model)

Sequence of entity 1 (Y), FASTA

>9LOV_1 RNA (45-MER) (chains Y)
UCUCAGUCAGUCAGUCUCAGUCAGUCAGUCUCAGUCAGUCAGUCU

Sequence of entity 2 (X), FASTA

>9LOV_2 RNA (45-MER) (chains X)
AGACUGACUGACUGAGACUGACUGACUGAGACUGACUGACUGAGA

Sequence of entity 3 (A), FASTA

>9LOV_3 ATP-dependent RNA helicase DHX58 (chains A)
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIRKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD

Sequence of entity 4 (B, C), FASTA

>9LOV_4 Interferon-induced helicase C domain-containing protein 1 (chains B, C)
MGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDH
LDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKS
CDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKL
KNNRLKKENKPVIPLPQILGLTASPGVGRATKQAKAEEHILKLCANLDAFTIKTVKENLD
QLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQME
KKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSD
EGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRN
TIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPM
TQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARAD
ESTYVLVAHSGSGVIERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKM
KTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKT
LQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVEL
PITFPNLDYSECCLFSDED

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	3
ZN	Zinc ion	Zn	3
MG	Magnesium ion	Mg	3

Primary citation

LGP2:MDA5:dsRNA filament. Kurihara, N., Isayama, Y., Nureki, O. et al. To be published.

Other PDB entries of the same protein (UniProt Q96C10 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EQT 2.0 Å, Crystal structure of human LGP2 C-terminal domain in complex with dsRNA
2W4R 2.6 Å, Crystal structure of the regulatory domain of human LGP2
9LOU 3.36 Å, LGP2:dsRNA complex
2RQA Solution structure of LGP2 CTD

Browse structure collections

About this viewer

MolViewer shows 9LOV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.