2WA0: Human MAGEA4

Crystal structure of the human MAGEA4. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Mar 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,749
Mol. weight: 27.42 kDa
Released: 10 Mar 2009

Explore 2WA0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WA0 contains 15 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	102-126	25
β-strand	131-132	2	1
α-helix	133-139	7
α-helix	145-147	3
α-helix	148-158	11
α-helix	159-163	5
β-strand	165-169	5	1
β-strand	176-181	6	1
α-helix	182-184	3
α-helix	200-213	14
β-strand	217-218	2	2
α-helix	219-228	10
β-strand	237	1	3
β-strand	241	1	3
α-helix	243-245	3
α-helix	246-250	5
α-helix	251-253	3
β-strand	257-260	4	2
β-strand	271-274	4	2
α-helix	276-281	6
α-helix	284-295	12
α-helix	301-304	4
α-helix	305-309	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Melanoma-associated antigen 4	A	protein	240	HOMO SAPIENS	P43358 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WA0_1 MELANOMA-ASSOCIATED ANTIGEN 4 (chains A)
MHHHHHHSSGVDLGTENLYFQSMDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEML
ERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIF
PKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYL
EYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV

Primary citation

Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding. Newman, J.A., Cooper, C.D.O., Roos, A.K. et al. PLoS One (2016) 11:48762. DOI 10.1371/JOURNAL.PONE.0148762 · PubMed

Other PDB entries of the same protein (UniProt P43358 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TRN 1.35 Å, Crystal structure of HLA A2*01-AVYDGREHTV
1I4F 1.4 Å, Crystal structure of HLA-A*0201/MAGE-A4-peptide complex
33CG 2.2 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-6
33CI 2.2 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-58
33CH 2.4 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-4
9BD3 2.58 Å, Structure of the MAGEA4 MHD-RAD18 R6BD Complex
8ES8 2.65 Å, CryoEM structure of PN45545 TCR-CD3 in complex with HLA-A2 MAGEA4 (230-239)
6TRO 3.0 Å, Crystal structure of the T-cell receptor GVY01 bound to HLA A2*01-GVYDGREHTV
8FJA 3.0 Å, CryoEM structure of HLA-A2 MAGEA4 (230-239) in complex with REGN6972 Fab
8ES9 3.25 Å, CryoEM structure of PN45428 TCR-CD3 in complex with HLA-A2 MAGEA4
7UOA 3.5 Å, MAGEA4-MTP1 linear peptide complex

Browse structure collections

About this viewer

MolViewer shows 2WA0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.