2WFS: Nucleoprotein

Fitting of influenza virus NP structure into the 9-fold symmetryzed cryoEM reconstruction of an active RNP particle. Determined by electron microscopy at 12.0 Å resolution. Released 7 Jul 2009.

Method: Electron microscopy
Resolution: 12.0 Å
Organism: INFLUENZA A VIRUS
Chains: 9
Atoms: 15,336
Mol. weight: 511.25 kDa
Released: 7 Jul 2009

Explore 2WFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WFS contains 171 α-helices and 153 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H and I: 19 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	24-47	24
β-strand	56	1	1
α-helix	57-70	14
β-strand	93-99	7	2
β-strand	104-110	7	2
α-helix	113-123	11
α-helix	130-147	18
α-helix	151-157	7
α-helix	161-166	6
α-helix	178-181	4
α-helix	186-201	16
α-helix	215-229	15
α-helix	233-243	11
α-helix	250-262	13
α-helix	278-286	9
α-helix	291-294	4
α-helix	301-306	6
β-strand	313-316	4	1
α-helix	322-334	13
β-strand	340	1	3
α-helix	341-348	8
α-helix	365-366	2
β-strand	375-378	4	1
β-strand	386	1	4
β-strand	389	1	5
β-strand	407	1	6
β-strand	412	1	7
β-strand	416-417	2	8
β-strand	420	1	6
α-helix	422-426	5
α-helix	440-450	11
β-strand	456-457	2	9
β-strand	463	1	10
β-strand	464	1	4
β-strand	475	1	10
β-strand	487	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A, B, C, D, E, F, G, H, I	protein	499	INFLUENZA A VIRUS	P03466 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>2WFS_1 NUCLEOPROTEIN (chains A, B, C, D, E, F, G, H, I)
RSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMV
LSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWRRELILYDKEEIRRIWRQANNGD
DATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVG
TMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRN
PGNAEFEDLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLL
QNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTKVVPRGKLSTRGVQIAS
NENMETMESSTLELRSRYWAIRTRSGGNTNQQRASSGQISIQPTFSVQRNLPFDRPTIMA
AFTGNTEGRTSDMRTEIIRLMESARPEDVSFQGRGVFELSDEKATSPIVPSFDMSNEGSY
FFGDNAEEYDNLEHHHHHH

Primary citation

The Structure of a Biologically Active Influenza Virus Ribonucleoprotein Complex. Coloma, R., Valpuesta, J.M., Arranz, R. et al. PLoS Pathog (2009) 5:00491. DOI 10.1371/JOURNAL.PPAT.1000491 · PubMed

Other PDB entries of the same protein (UniProt P03466 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NPZ 1.43 Å, Porcine (Sus scrofa) Major Histocompatibility Complex, class I, presenting EFEDLTFLA
5NQ3 1.57 Å, 'Porcine (Sus scrofa) Major Histocompatibility Complex, class I, with human beta2 micro…
2BST 2.1 Å, Crystal structures and KIR3DL1 recognition of three immunodominant viral peptides…
5V5O 2.24 Å, Structure of NLS2K of influenza A virus nucleoprotein bound to importin alpha
4ZDU 2.3 Å, Crystal structure of importin-alpha bound to a non-classical nuclear localization signal…
4NQV 2.39 Å, Crystal Structure of HLA A*0101 in complex with NP44, an 9-mer influenza epitope

Browse structure collections

About this viewer

MolViewer shows 2WFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.