2WG3: Desert hedgehog protein N-product

Crystal structure of the complex between human hedgehog-interacting protein HIP and desert hedgehog without calcium. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Jun 2009.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 8,980
Mol. weight: 141.9 kDa
Ligands: ZN, PO4, NAG
Released: 30 Jun 2009

Explore 2WG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WG3 contains 36 α-helices and 85 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	1
α-helix	74-76	3
β-strand	78-79	2	2
β-strand	86-87	2	1
α-helix	95-97	3
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	140-142	3
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-175	3	1
β-strand	182-185	4	1

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	40-44	5
β-strand	48-49	2	3
β-strand	78-79	2	4
β-strand	85-87	3	3
α-helix	95-97	3
β-strand	98-99	2	4
α-helix	101-117	17
β-strand	123-127	5	3
α-helix	140-142	3
β-strand	146-151	6	3
α-helix	156-158	3
α-helix	159-168	10
β-strand	173-178	6	3
β-strand	181-185	5	3

Chain C: 14 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	217-226	10	5
β-strand	229-233	5	5
β-strand	242-246	5	5
β-strand	250-254	5	5
α-helix	255	1
α-helix	259	1
β-strand	260	1	5
α-helix	261	1
β-strand	266-267	2	5
β-strand	272	1	6
β-strand	284-289	6	6
α-helix	293-296	4
β-strand	298-305	8	6
β-strand	317-325	9	6
β-strand	326	1	7
β-strand	334	1	7
α-helix	336-338	3
β-strand	340-347	8	6
β-strand	354-359	6	8
α-helix	364	1
β-strand	365-369	5	8
α-helix	376-381	6
β-strand	391-395	5	8
β-strand	396	1	9
β-strand	407	1	9
β-strand	424-427	4	8
β-strand	434	1	10
β-strand	435-438	4	11
β-strand	448-453	6	11
β-strand	463-468	6	11
α-helix	477-480	4
β-strand	481-482	2	11
α-helix	483	1
β-strand	491-496	6	10
β-strand	509-513	5	10
β-strand	518-522	5	10
β-strand	531-535	5	10
β-strand	537-539	3	5
β-strand	550-556	7	5
β-strand	562-567	6	5
α-helix	571-573	3
β-strand	577-583	7	5
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	12
β-strand	623-625	3	12
α-helix	626	1
β-strand	629-630	2	13
β-strand	636-637	2	13
α-helix	638	1

Chain D: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	217-226	10	14
β-strand	229-233	5	14
β-strand	242-246	5	14
β-strand	250-254	5	14
β-strand	260	1	14
β-strand	266-267	2	14
β-strand	284-289	6	15
α-helix	293-296	4
β-strand	298-305	8	15
β-strand	318-327	10	15
β-strand	330-346	17	15
β-strand	354-359	6	16
α-helix	364	1
β-strand	365-369	5	16
α-helix	376-381	6
β-strand	391-395	5	16
β-strand	396	1	17
β-strand	407	1	17
β-strand	424-427	4	16
β-strand	434	1	18
α-helix	435	1
β-strand	436-438	3	19
β-strand	446-453	8	19
β-strand	463-469	7	19
α-helix	477-479	3
β-strand	481-482	2	19
β-strand	491-497	7	18
β-strand	508-513	6	18
β-strand	518-523	6	18
β-strand	530-535	6	18
β-strand	537-538	2	14
β-strand	550-556	7	14
β-strand	562-567	6	14
α-helix	571-573	3
β-strand	577-583	7	14
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	20
β-strand	623-625	3	20
α-helix	626	1
β-strand	630	1	21
β-strand	636	1	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Desert hedgehog protein N-product	A, B	protein	164	HOMO SAPIENS	O43323 (AlphaFold model)
Hedgehog-interacting protein	C, D	protein	463	HOMO SAPIENS	Q96QV1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2WG3_1 DESERT HEDGEHOG PROTEIN N-PRODUCT (chains A, B)
ALVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRL
MTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK
YGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVLEHHHHHH

Sequence of entity 2 (C, D), FASTA

>2WG3_2 HEDGEHOG-INTERACTING PROTEIN (chains C, D)
HNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQ
SGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQ
VDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVL
RLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCS
DSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGD
RNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQ
THNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDF
CRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
PO4	Phosphate ion	O4 P	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural Insights Into Hedgehog Ligand Sequestration by the Human Hedgehog-Interacting Protein Hip. Bishop, B., Aricescu, A.R., Harlos, K. et al. Nat Struct Mol Biol (2009) 16:698. DOI 10.1038/NSMB.1607 · PubMed

Other PDB entries of the same protein (UniProt O43323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WFQ 1.85 Å, Crystal structure of the N-terminal signalling domain of human Dhh without calcium
3N1G 1.9 Å, Crystal structure of DhhN bound to BOCFn3
2WFR 1.95 Å, Crystal structure of the N-terminal signalling domain of human Dhh with calcium
3N1Q 2.89 Å, Crystal Structure of DhhN bound to CDOFn3

Browse structure collections

About this viewer

MolViewer shows 2WG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.