3N1Q: DhhN

Crystal Structure of DhhN bound to CDOFn3. Determined by X-ray diffraction at 2.89 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 2.89 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,767
Mol. weight: 92.82 kDa
Ligands: ZN, CA
Released: 2 Jun 2010

Explore 3N1Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1Q contains 27 α-helices and 48 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	5
α-helix	72-74	3
β-strand	78-79	2	6
β-strand	85-87	3	5
β-strand	98-99	2	6
α-helix	101-117	17
β-strand	123-127	5	5
α-helix	136	1
α-helix	140-143	4
β-strand	146-151	6	5
α-helix	156-158	3
α-helix	159-169	11
β-strand	173-175	3	5
β-strand	182-185	4	5

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	1
α-helix	73-76	4
β-strand	78-79	2	2
β-strand	86-87	2	1
β-strand	98-99	2	2
α-helix	101-117	17
β-strand	123-127	5	1
α-helix	136	1
α-helix	140-143	4
β-strand	146-151	6	1
α-helix	156-158	3
α-helix	159-169	11
β-strand	173-178	6	1
β-strand	181-185	5	1

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	831-837	7	3
β-strand	843-848	6	3
β-strand	861-868	8	4
β-strand	878-883	6	4
β-strand	888-891	4	3
α-helix	894-895	2
β-strand	899-907	9	4
β-strand	912	1	4
α-helix	913-915	3
α-helix	917-918	2
β-strand	919-922	4	4

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	831-837	7	7
β-strand	843-848	6	7
β-strand	861-868	8	8
α-helix	874-876	3
β-strand	878-883	6	8
β-strand	888-891	4	7
β-strand	899-907	9	8
β-strand	912	1	8
α-helix	914-918	5
β-strand	919-922	4	8

Chain E: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	42-44	3
β-strand	48-49	2	9
β-strand	78-79	2	10
β-strand	85-87	3	9
β-strand	98-99	2	10
α-helix	101-117	17
β-strand	123-127	5	9
α-helix	140-143	4
β-strand	146-151	6	9
α-helix	156-158	3
α-helix	159-169	11
β-strand	173-178	6	9
β-strand	181-185	5	9

Chain F: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	832-837	6	11
β-strand	843-847	5	11
β-strand	861-868	8	12
α-helix	874-876	3
β-strand	878-881	4	12
β-strand	888-891	4	11
α-helix	894-895	2
β-strand	899-907	9	12
β-strand	912	1	12
α-helix	913-915	3
β-strand	919-922	4	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Desert hedgehog protein	A, B, E	protein	170	Homo sapiens	O43323 (AlphaFold model)
Cell adhesion molecule-related/down-regulated by oncogenes	C, D, F	protein	102	Homo sapiens	Q4KMG0 (AlphaFold model)

Sequence of entity 1 (A, B, E), FASTA

>3N1Q_1 Desert hedgehog protein (chains A, B, E)
GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVP
NYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDS
LHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKAD

Sequence of entity 2 (C, D, F), FASTA

>3N1Q_2 Cell adhesion molecule-related/down-regulated by oncogenes (chains C, D, F)
GSTPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVV
EGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
CA	Calcium ion	Ca	6

Primary citation

All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. J Biol Chem (2010) 285:24584-24590. DOI 10.1074/jbc.M110.131680 · PubMed

Other PDB entries of the same protein (UniProt O43323 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WFQ 1.85 Å, Crystal structure of the N-terminal signalling domain of human Dhh without calcium
3N1G 1.9 Å, Crystal structure of DhhN bound to BOCFn3
2WFR 1.95 Å, Crystal structure of the N-terminal signalling domain of human Dhh with calcium
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 3N1Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.