GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate. Determined by X-ray diffraction at 1.22 Å resolution. Released 3 Nov 2009.
Explore 2WQ3 in 3D Show helices and sheets RCSB PDB PDBe
2WQ3 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-30 | 29 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| General control protein GCN4 | A | protein | 33 | SACCHAROMYCES CEREVISIAE | P03069 (AlphaFold model) |
>2WQ3_1 GENERAL CONTROL PROTEIN GCN4 (chains A) RMKQLEDKIEENTSKIYHNTNEIARNTKLVGER
A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core. Hartmann, M.D., Ridderbusch, O., Zeth, K. et al. Proc Natl Acad Sci U S A (2009) 106:16950. DOI 10.1073/PNAS.0907256106 · PubMed
Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WQ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.