2WTR: Full length Arrestin2

Full length Arrestin2. Determined by X-ray diffraction at 2.9 Å resolution. Released 29 Sept 2009.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: BOS TAURUS
Chains: 2
Atoms: 5,826
Mol. weight: 94.94 kDa
Ligands: BA
Released: 29 Sept 2009

Explore 2WTR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WTR contains 19 α-helices and 59 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	19-22	4	1
β-strand	27-29	3	2
β-strand	34	1	2
α-helix	35-36	2
β-strand	37-42	6	1
α-helix	45-48	4
β-strand	52-63	12	3
β-strand	75-87	13	3
α-helix	96-98	3
α-helix	99-107	9
β-strand	112-117	6	1
α-helix	124-126	3
β-strand	127-129	3	3
α-helix	133-138	6
β-strand	140-151	12	3
β-strand	164-168	5	3
β-strand	170-172	3	2
α-helix	181-184	4
β-strand	185-189	5	4
β-strand	197-201	5	4
β-strand	203	1	4
β-strand	207-209	3	5
α-helix	212-213	2
β-strand	214-222	9	4
β-strand	228-241	14	6
β-strand	247-258	12	6
β-strand	262	1	6
β-strand	267-274	8	4
β-strand	288-289	2	3
β-strand	300	1	3
α-helix	301-306	6
β-strand	317-329	13	6
β-strand	342-348	7	6
β-strand	350-352	3	5
α-helix	353-355	3
β-strand	386-390	5	1

Chain B: 9 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	7
β-strand	19-22	4	7
β-strand	26-29	4	8
β-strand	34	1	8
β-strand	37-39	3	9
β-strand	40	1	7
β-strand	42	1	10
β-strand	52-56	5	11
β-strand	58-63	6	11
β-strand	75-81	7	11
β-strand	84-87	4	11
α-helix	96-98	3
α-helix	99-104	6
β-strand	112	1	10
β-strand	115-117	3	9
α-helix	124-126	3
β-strand	127-129	3	11
β-strand	140-151	12	11
β-strand	163-168	6	11
β-strand	169-172	4	8
α-helix	182-184	3
β-strand	185-189	5	12
β-strand	197-203	7	12
β-strand	207-209	3	13
α-helix	212-213	2
β-strand	214-222	9	12
β-strand	228-241	14	14
β-strand	247-258	12	14
β-strand	262	1	14
β-strand	266-274	9	12
α-helix	279-281	3
β-strand	288-289	2	11
β-strand	300	1	11
α-helix	301-304	4
α-helix	313-315	3
β-strand	317-318	2	14
β-strand	321-329	9	14
β-strand	341-348	8	14
β-strand	350-352	3	13
α-helix	353-354	2
β-strand	386-390	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	418	BOS TAURUS	P17870 (AlphaFold model)
Beta-arrestin-1	B	protein	418	BOS TAURUS	P17870 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WTR_1 BETA-ARRESTIN-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPRLNDR

Sequence of entity 2 (B), FASTA

>2WTR_2 BETA-ARRESTIN-1 (chains B)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVVGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPRLNDR

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	4

Primary citation

A New Dimeric Crystal Form for Arrestin2. Zhou, H.G., Standfuss, J., Watson, K.A. et al. To be published.

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 2WTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.